KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1470Help
Entry
Thexy_1470        CDS       T01505                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thexy_1470
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thexy_1470
Enzymes [BR:txy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thexy_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1522065..1522847)
Genome map
AA seq 260 aa AA seqDB search
MILDDIIFKKKKQVEMKKIKKTLDDILKEIKNDKDVRNFKEALKAEDISIIAEIKKASPS
RGTILDDFDHIKIAKLYEDANIEAISVLTEKNYFKGDDSYINDVKEVTSKPILRKDFIFD
EYQIYESKLIGADAVLLIVAVLGDDLKKFYDIAKKIGLDAIVEVHDERELEIALNANVDI
LGINNRDLKDFRVDLKTTERLIRYVPSGVLLVSESGIKTPDDVKFLKSLGVNAVLIGETF
MNIIKNGGKIDDFVIQSKGV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgatgatattatctttaagaaaaaaaaacaggtggaaatgaaaaaaattaaa
aaaacgctggatgatatattaaaagaaattaaaaacgacaaagatgtgaggaattttaaa
gaagcgttgaaagctgaggatatatcaataatagctgaaataaaaaaagcttctccgtcg
agaggaacaattttagatgactttgatcatataaaaattgctaaattgtatgaagatgcc
aatatcgaagccatatctgttcttacagaaaaaaattattttaaaggagatgattcatat
ataaacgatgtgaaagaagtaacatcaaagccaattcttagaaaagacttcatatttgac
gaataccaaatatacgaaagcaaattaattggtgcagatgctgtcttgctaatagtggct
gtacttggagatgatttaaagaagttttacgatattgcaaaaaaaattggattagatgcc
attgttgaggttcatgacgaacgagaacttgaaatagcattaaatgcgaatgtagatatt
ttgggtataaataacagggacttaaaggattttcgcgttgatttaaagacgacagaaagg
cttattagatacgtgccaagtggtgttctgttggtatctgaaagtggcataaagacccct
gatgacgtaaaatttttaaaatcattaggtgtaaatgctgtcctaattggtgaaacattt
atgaatataatcaaaaatggtgggaaaattgatgatttcgtaattcaatcaaagggtgtt
taa

DBGET integrated database retrieval system