KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1470Help
Entry
Thexy_1470        CDS       T01505                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
txy01100  Metabolic pathways
txy01110  Biosynthesis of secondary metabolites
txy01130  Biosynthesis of antibiotics
txy01230  Biosynthesis of amino acids
Module
txy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thexy_1470
Enzymes [BR:txy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thexy_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C DAHP_synth_1 DUF2671 Csm2_III-A
Motif
Other DBs
NCBI-ProteinID: AEF17502
JGI: Thexy_1470
UniProt: F6BGV5
Position
complement(1522065..1522847)
Genome map
AA seq 260 aa AA seqDB search
MILDDIIFKKKKQVEMKKIKKTLDDILKEIKNDKDVRNFKEALKAEDISIIAEIKKASPS
RGTILDDFDHIKIAKLYEDANIEAISVLTEKNYFKGDDSYINDVKEVTSKPILRKDFIFD
EYQIYESKLIGADAVLLIVAVLGDDLKKFYDIAKKIGLDAIVEVHDERELEIALNANVDI
LGINNRDLKDFRVDLKTTERLIRYVPSGVLLVSESGIKTPDDVKFLKSLGVNAVLIGETF
MNIIKNGGKIDDFVIQSKGV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgatgatattatctttaagaaaaaaaaacaggtggaaatgaaaaaaattaaa
aaaacgctggatgatatattaaaagaaattaaaaacgacaaagatgtgaggaattttaaa
gaagcgttgaaagctgaggatatatcaataatagctgaaataaaaaaagcttctccgtcg
agaggaacaattttagatgactttgatcatataaaaattgctaaattgtatgaagatgcc
aatatcgaagccatatctgttcttacagaaaaaaattattttaaaggagatgattcatat
ataaacgatgtgaaagaagtaacatcaaagccaattcttagaaaagacttcatatttgac
gaataccaaatatacgaaagcaaattaattggtgcagatgctgtcttgctaatagtggct
gtacttggagatgatttaaagaagttttacgatattgcaaaaaaaattggattagatgcc
attgttgaggttcatgacgaacgagaacttgaaatagcattaaatgcgaatgtagatatt
ttgggtataaataacagggacttaaaggattttcgcgttgatttaaagacgacagaaagg
cttattagatacgtgccaagtggtgttctgttggtatctgaaagtggcataaagacccct
gatgacgtaaaatttttaaaatcattaggtgtaaatgctgtcctaattggtgaaacattt
atgaatataatcaaaaatggtgggaaaattgatgatttcgtaattcaatcaaagggtgtt
taa

DBGET integrated database retrieval system