KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1706Help
Entry
Thexy_1706        CDS       T01505                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thexy_1706
   00052 Galactose metabolism
    Thexy_1706
   00500 Starch and sucrose metabolism
    Thexy_1706
   00520 Amino sugar and nucleotide sugar metabolism
    Thexy_1706
Enzymes [BR:txy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thexy_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1754749..1755663)
Genome map
AA seq 304 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVNSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKGKENLLNLVEDITNMVDIHYIRQKEPKGLGHAIYCAHTFV
GDEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCSIIGVQEVPKSEVDKYGIVDANMIDDR
LYRVNNLVEKPKKEEAPSNMAILGRYIISPRIFDILKDLRPGAGGEIQLTDALKVLLDYE
AIYAYNFEGKRYDVGDKLGYLKATVEYALKRDDLKDDFIKYLKTLKLSDHDVLDEVAISG
LNVK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagcgataattccagcggcaggacttggaacaaggtttttacctgca
acaaaagcacagccaaaggagatgcttccaatagttgataagccgactatacaatatata
gtggaagaagccgtaaactctggcatagaggatatactcataataacaggaagaaacaaa
agagccatagaggaccatttcgacaaatctgtagaattagagttagaattaaagaaaaaa
ggcaaagaaaatcttttaaacctcgttgaagatataacaaatatggtggatatacattat
ataaggcaaaaagagccgaaaggacttggacatgccatttattgtgcacatacatttgta
ggagatgagccatttgcagttcttttaggggacgatatagttgatgcagaagtacccgta
ttgaagcagatgatagaacagtacgaaagatacaactgttccataataggcgtacaagaa
gtgccaaaaagtgaagtagacaaatacggcatagtagatgccaacatgattgatgacagg
ctgtatagagtaaacaacctagtagagaagccaaaaaaagaagaagcaccgtcaaacatg
gccatacttggaagatatataatatcgccaaggatatttgatatactaaaagacttaagg
cccggagcaggtggtgaaatacagcttactgatgcacttaaagtgctattagactatgaa
gcaatatacgcatataattttgaaggcaagaggtatgatgtaggagataaattagggtat
cttaaggctactgttgaatatgctttgaaaagagacgacttaaaagacgactttataaaa
tatctaaaaactttaaaattaagtgaccatgatgttttggatgaagttgcgatttctggt
ttgaatgtaaaataa

DBGET integrated database retrieval system