KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1711Help
Entry
Thexy_1711        CDS       T01505                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_1711
   00030 Pentose phosphate pathway
    Thexy_1711
   00051 Fructose and mannose metabolism
    Thexy_1711
   00052 Galactose metabolism
    Thexy_1711
   00500 Starch and sucrose metabolism
    Thexy_1711
   00520 Amino sugar and nucleotide sugar metabolism
    Thexy_1711
  Nucleotide metabolism
   00230 Purine metabolism
    Thexy_1711
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thexy_1711
Enzymes [BR:txy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Thexy_1711
    5.4.2.8  phosphomannomutase
     Thexy_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1758714..1760084)
Genome map
AA seq 456 aa AA seqDB search
MALNQNMFRMYDIRGVWNDDLTEETAELIGKAFGTYIQNEKNVKDVIVGRDNRISSKPIR
NAVVKGLTSTGCNVLDIGVLSTPAFYYSRILYNYDAGLMITASHNPPQFNGFKVAFGPST
IYGDELKKLYHIAEKGDFKTGTGSLKYAYPIQSYIKMIQDKVRLGDKKLKVVVDCGNGTC
SNIYPDIIYGLGCEVYPLYCESDPTFPNHFPDPVNADNLKDLISEVKRLSADVGIAFDGD
GDRIGVVDEKGNIIWGDMLMVLYWREIMKKHPGADAIVEVKCSKALPEEIKKLGGNPIFY
KTGHSLIKAKMKEINAVFTGEMSGHMFFADEYYGYDDAAYAAARLLRILSNTNKTLSELL
SDVPKYPSTPELRLHCDDEKKFDVVKGVTKHFREKGYELIDIDGARVMFDGGWGLVRASN
TGPELIVRCEADTEKRLEEIKDELAEVLKKYGVELK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaatcaaaatatgtttaggatgtacgatatacgcggtgtatggaatgatgat
cttaccgaagaaacagcagagcttattggcaaagccttcggtacatatattcaaaatgaa
aaaaacgtaaaagatgtaattgtaggcagagacaacaggatatcttcaaaacccataaga
aatgctgtggtaaagggacttacttctactggatgtaatgtgctggatatcggtgttctg
tctacgcctgctttttactattcacgcatactatataattacgacgcaggacttatgata
acagcaagccataatccaccgcagtttaacggatttaaagttgcatttggaccatctact
atatatggtgatgagcttaaaaagctatatcatattgcagagaaaggtgatttcaagaca
gggacaggttctttgaaatacgcataccctatacaaagctacataaagatgattcaggat
aaggtgagacttggcgataaaaagcttaaagttgttgtagactgtggaaacggtacatgc
tcaaacatatatcctgatattatatacgggcttgggtgcgaagtatacccactgtactgt
gaatcagatccaacatttccaaaccattttcctgatccagtgaatgcagacaatctgaaa
gacttgataagtgaggttaaaagacttagcgcagacgttggcatagcttttgacggtgat
ggagataggattggcgtcgttgatgagaagggcaacataatctggggcgatatgctgatg
gtgctttactggagggaaataatgaaaaagcatccaggtgcagatgccatagtcgaagta
aaatgttcaaaggcactgcctgaagagataaagaaacttggtggaaatccgatcttctat
aagactggtcacagccttataaaggcaaagatgaaagaaatcaatgctgtctttacaggc
gagatgtcaggccacatgttctttgcagatgagtattatggctatgatgatgcggcgtat
gctgcagcaagactccttagaatactttctaatacgaataagacattgtcagagcttttg
tcagatgtgccgaaatatccgtcgactccggaattgagattgcactgcgatgatgaaaag
aaatttgatgttgtaaaaggtgtgacaaaacattttagagaaaaaggatatgaattgatc
gatatcgatggtgcaagagtcatgtttgacggcggatgggggcttgttagagcatctaat
acaggacctgaattgattgtaaggtgtgaagctgatactgaaaaaaggcttgaagagata
aaagatgagcttgcagaggtattaaaaaaatacggtgttgagcttaaataa

DBGET integrated database retrieval system