KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1730Help
Entry
Thexy_1730        CDS       T01505                                 

Definition
cellulose 1,4-beta-cellobiosidase (EC:3.2.1.91)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
txy  Thermoanaerobacterium xylanolyticum
Brite
Enzymes [BR:txy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Thexy_1730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1784164..1787862)
Genome map
AA seq 1232 aa AA seqDB search
MSLKINKVVSFITVFIMILGTSIYMPHVKVFADNTSTNLVSNGDFENGTLDGWTKQGNPT
LEVTTEQAIGQYSMKVTGRTQTYEGPAYSFLGKMQKGESYNISLKVRLVSGQNSSNPLIT
VTMFREDDNGKHYDTIAWQKQVSEDSWTTINGTYTLDYTGTLKTLYMYVESPDPTLEYYI
DDVVVTPQNPIQVGNVIANGTFENGNTSGWVGTGSSVVKAVYGVAHSGEYSLLTTGRTAN
WNGPSYDLTGKVVPGQQYNVDFWVKFIDGNDTEQIKATVKATSDKDNYIQVDDFADVSKG
EWTEIKGSFTLPVADYNSISIYVESQNPTLEFYIDDFSVIGEIANNQITIQNDIPDLYSV
FKDYFPIGVAVDPSRLNDTDPHAQLTAKHFNMLVAENAMKPESLQPTEGNFTFDNADKIV
DYAIAHNMKMRGHTLLWHNQVPDWFFQDPSDPSKPASRDLLLQRLKTHITTVLDHFKTKY
GSQNPIIGWDVVNEVLDDNGNLRNSKWLQIIGPDYIEKAFEYAHEADPSMKLFINDYNIE
NNGVKTQAMYDLVRKLKSEGVPISGIGMQMHININSNIDNIKASIEKLASLGVEIQVTEL
DMDMNGNVSNEALLKQARLYKQLFDLFKAEKQYITAVVFWGVSDDVTWLSKPNAPLLFDS
KLQAKPAFWAVVDPSKAIPDIQSAKALEGSPTIGANVDSSWKLVKPLYVNTYVEGTVGAT
ATVKSMWDTKNLYLLVQVSDNTPSSNDGIEIFVDKNDNKSTSYETDDEHYTIKRDGTESS
DITKYVTSNADGYVAQIAIPIEDINPAVNDKIGFDIRINDDKGNIDAITVWNDYTNSQNT
NTSYFGDIVLSKSAQIATAIYGTPVIDGKVDDIWNNVEPISTNTWVLGSNGATATAKMMW
DDKYLYVLAVVTDPNLNKSSVNPYEQDSVEVFVDQNNDKTTYYENDDGQYRVNYDNEQSF
GGSTNSNGFKSATSLTQSGYIVEEAIPWTSITPSNGTIIGFDLQVNDADENGKRTGVVTW
CDPSGNSWQDTSGFGNLMLTGKSSGALKKDVTFNDIKDNWAKDVIEVLASRHIVEGMTDT
QYEPNKTVTRAEFTAMILRLLNIKEETYNGEFSDVKSGDWYANAIEAAYKAGIIEGDGKN
ARPNDNITREEMTAIAMRAYEMLTQYKEENIGATSFSDDKSISDWARNVVANAAKLGIVN
GEPNNVFVPKGVATRAEAAAIIYGLLEKTNSL
NT seq 3699 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaaaataaataaagttgtatcatttattacagtttttataatgattttaggg
acgtcaatatacatgccacatgtaaaagtgtttgcggacaacaccagcactaatttagtt
tccaacggtgattttgaaaatgggactttagatggatggacaaaacagggaaatccaaca
ttagaagtaacgactgagcaagcaattgggcaatatagtatgaaagttactggtaggacg
cagacatatgaaggacctgcatatagctttttaggaaaaatgcagaaaggtgaatcatac
aatatatcgcttaaagttagacttgtttccggacaaaattcgtctaatcctttgattact
gtaactatgtttagagaagatgacaatggcaagcattatgatacaatagcttggcaaaaa
caagtttctgaagattcatggactactataaatgggacttatacgctggattatactgga
acattaaaaacattatatatgtacgtggaatcaccagatccaacgctggaatactatatt
gatgatgttgtagtgacaccacaaaatccaatacaagtagggaatgtaattgccaatgga
acttttgaaaatggaaatacttctggatgggttggaacaggttcatctgttgttaaagca
gtatatggagtagctcatagcggagaatatagcttattgacgacagggaggacagctaat
tggaatggtcctagttatgatttgactggcaaagtagttccaggacagcaatacaatgtt
gatttttgggtgaaatttattgatggtaatgatacagagcaaattaaggctactgttaaa
gcgacttctgacaaagataattatatacaagttgatgattttgcagatgtaagtaaaggc
gaatggacagaaataaaaggcagttttactttacctgttgcagattacaacagcattagc
atctatgtagaatctcaaaatcctactttagagttttacattgatgatttttctgtaata
ggtgaaattgcaaataatcagattactattcaaaatgacattccagatttgtactctgta
tttaaagactattttcctataggcgttgcggttgatccaagtagattaaatgatacggat
ccgcatgctcaattgacggctaaacattttaatatgcttgttgcagaaaatgccatgaaa
ccagaaagtttacagcctacagaaggaaactttacttttgataatgcagataagattgtt
gattatgcaatagcacataatatgaagatgagaggtcatacattgctttggcataatcag
gttccggattggtttttccaggacccatctgatccgtctaaaccagcttcaagggattta
ctgcttcaaagattaaagacccacataacaactgtgttagaccattttaaaacaaaatat
ggttctcagaatccaataattggatgggatgttgtaaatgaagttcttgatgataatggc
aatttaagaaattctaagtggttacaaattataggacctgattatatagaaaaagctttt
gaatatgcacatgaagcagatccatctatgaaattgtttattaatgattacaatatcgaa
aataatggtgttaaaacacaggcaatgtatgacttagtgagaaagttaaaaagtgaaggt
gtgccgataagtggaataggcatgcaaatgcacataaatataaattcaaatatagataat
ataaaagcttctatagaaaaacttgcatcattaggtgtggaaatacaggtaactgaatta
gatatggatatgaatggtaatgtatctaatgaagcactgctcaagcaagcgagattgtat
aaacaattgtttgatttatttaaagcagaaaaacaatatataactgctgtggttttttgg
ggagtttcagatgatgtaacttggcttagtaagccaaatgctccactgctttttgattca
aagttacaagcaaaaccggcattctgggcagtagtagatccaagcaaagctatacccgat
attcaatctgcgaaagctttagaaggttcacctacgattggtgcaaatgttgatagttct
tggaaacttgttaaaccattgtatgtaaatacttatgtagaaggaactgtcggagcaact
gctactgttaagtctatgtgggatactaaaaacttatatttgttagtacaagtttcagac
aatactccatctagtaatgatggtatagaaatttttgtagataagaatgataataaatct
acttcttatgaaactgatgatgaacattatacaattaaaagggatggtacagagagttca
gatattaccaaatatgtgacatctaatgctgacggatatgtagcacagatagccattcca
attgaagatattaatcctgcagttaatgataaaattgggtttgacattagaataaatgat
gataaaggcaatatagatgcaataacagtttggaatgattatacaaatagtcaaaatact
aatacatcatattttggtgatattgtattgtcaaaatctgcacaaatcgcaacagctata
tatggcactcctgttattgatggcaaagtagacgatatttggaataatgttgaacctatt
tcaacaaatacatgggttttgggctcaaatggtgctactgcgacagcaaagatgatgtgg
gacgataaatatctttatgttttggcggttgttacagatccaaatctgaacaaatctagt
gtcaatccatacgaacaagattctgtagaagtttttgtagatcagaacaatgataagacg
acttattatgagaatgatgacggtcaatatagagttaattatgacaatgaacaaagcttt
gggggaagcactaattcaaatggttttaaatcggcaactagtcttacacaaagtggatat
attgtagaagaagctattccttggaccagtatcacgccatcaaatggcactataatagga
tttgatttgcaagttaatgatgcagatgaaaatggcaagaggacaggcgttgtcacatgg
tgtgatccaagcggaaattcatggcaagatacttcaggttttggtaatttgatgttaaca
ggtaagtcatctggcgcccttaaaaaagatgtgacgtttaatgatataaaagacaattgg
gcgaaagacgtaatagaagtattagcatcaaggcatatagtagaaggaatgacagacact
cagtatgaacccaataagacagtaacgagagcagaattcacagcaatgatactgaggctt
ttaaacataaaagaagaaacatacaatggagaatttagtgatgttaagagcggagactgg
tatgcaaacgcaatagaagcagcatacaaagcaggaataatagaaggtgacggaaagaac
gcaaggccaaatgacaatataacaagagaagagatgacagcaatagcaatgagagcatac
gagatgctgacacagtacaaagaagaaaacataggtgcgacatcatttagcgatgacaaa
tccataagcgactgggcaaggaatgtagtagcaaatgcagcgaaattaggaatagtaaat
ggagaacctaacaatgtgtttgtacctaaaggtgtagctacgagagcagaagcagcggct
atcatatatggcttattagagaaaacaaatagtctgtaa

DBGET integrated database retrieval system