KEGG   Thermoanaerobacterium xylanolyticum: Thexy_1897Help
Entry
Thexy_1897        CDS       T01505                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:txy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1967529..1969817)
Genome map
AA seq 762 aa AA seqDB search
MICASNVYENNIQLKIENKKVGIDMVEIIGTVEEIIFKNEQNGYAVLELNSKNDTITVVG
YMPFVGIGETLKVEGEWMTHPDYGEQVKVSKYETIAPSTLYGMERFLSSGLIRGIGPVMA
KKIVSKFGVDSLNIIESHPEKLLDIPGIGEERVKMISESYEQQKTLRDVMVFLQGYGIST
TNAIKIYRQYGDDSIELIKQNPYRLSDEIFGIGFRTADKIARAMGVDLHSSYRISSGTKY
VLIQYASNGHTYVPLELLLKEAAKLLEVSEEEVYDSLVLLAQSEKVKFETFEDGSHGVYY
IPYFVAENNTADKILNMTLTDVKPEDIDIESEISKIESDMGIHLADNQRVAVLESVKNSI
LVITGGPGTGKTTIINFIIKLFKKFKKSVALTAPTGRAAKRMTEATGFEAKTIHRLLEYS
YTEEEGRGFGKDDKNPLTEDVIIVDEASMIDILLMNALLKAIPLSSRLILVGDVDQLPSV
GAGNVLRDIIDSGLVKVIRLNKIYRQGKESLIVVNAHKINNGEYPVLNDKENDFFFINAS
SQDEILNIILDLCKRRLPEAYGFNPFTDIQVLSPTRKGLIGVINMNNELQRCLNPSKKGL
DERQMKDFTFRVGDKVMQMKNNYKMKWTKGDEKGEGVFNGDMGIIESIDNDSQELTVLFD
DDKRVVYDFADIDELSLSYCVTVHKSQGSEFPAVIMPMSFGPPMLLTRNLLYTAVTRAKK
LVVIVGQEKYLKSMIDNNLISKRYSGLLPKLMKVLKFMVEEN
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgatatgtgcttcaaatgtatatgaaaataatatacaattaaagatagaaaataaaaaa
gtagggatagatatggttgaaataataggtacagttgaggagataatttttaaaaatgaa
caaaatgggtatgctgtattagaacttaattcgaaaaatgacactatcaccgttgtagga
tatatgccttttgttggaataggtgagacgcttaaagttgaaggtgaatggatgacgcat
cctgactatggggaacaggtgaaagtttcgaagtatgagacgatagcgccgtcaacgttg
tatgggatggagaggtttttatcatctggactcattagaggtataggtcctgtcatggcg
aaaaagattgtctcaaaattcggcgtcgattctctaaacattatagaatctcatccagaa
aaattattggatatacctggaataggcgaagaaagagtaaagatgatatcagaatcttat
gagcagcagaagacattgagggacgtgatggtttttttacaaggttatggcatttctacc
acaaatgcaattaaaatatataggcaatacggcgatgattctatagaactcataaagcag
aatccgtacagactatcggatgaaatttttgggattggctttaggacggctgataagata
gctcgagcaatgggtgttgacttgcattccagctataggatttcatctggcacaaagtac
gttttgatacaatatgcatcaaatggccatacgtatgtgccacttgaacttttgcttaaa
gaagcagcaaaacttcttgaagtatcagaagaagaagtttatgattcgttggttcttctg
gcacaaagcgaaaaagtgaagtttgagacatttgaagatggctctcacggcgtgtattat
ataccgtattttgtagctgaaaacaacaccgcagataagattttaaacatgacgctgaca
gatgtaaagcctgaggatattgatattgaaagtgaaatatcgaagatagaatcagatatg
ggaattcatcttgcagacaatcagcgtgttgcagttttagaatctgtcaagaactcaatt
ctcgtcataacaggtggacctgggacgggaaagaccaccataataaatttcattataaag
ctttttaaaaaatttaaaaaatcggtagcattaactgcacctacaggaagagctgcaaag
aggatgactgaagctacaggttttgaagctaagacgatacatcgccttttagagtattca
tacactgaagaagaaggacgagggtttggaaaggatgataaaaacccattgacagaagat
gtcataatagtagacgaggcttcgatgatagacatattgcttatgaatgctcttcttaaa
gctattccgttaagctcaagattgatacttgttggagatgtggatcagcttccgtctgtt
ggagctggcaatgtgcttagagacatcatagatagcggcttggtaaaagttataaggctt
aataagatatacaggcaagggaaggaaagtttgatagtagtaaatgcccacaagataaac
aatggagagtaccctgtgttaaatgataaagaaaatgactttttctttataaatgcttca
tcacaagacgaaattttaaatattatattggatttatgtaaaaggcggttgcctgaagcg
tatggatttaacccttttacagatattcaagttttaagccccacgagaaaaggcttgata
ggtgtaataaacatgaacaatgaactgcaaaggtgcttaaatccttcgaaaaagggattg
gatgagaggcagatgaaagattttactttcagagtaggagacaaggtgatgcagatgaaa
aacaactacaagatgaagtggacaaaaggagacgaaaaaggtgaaggcgtctttaatggt
gatatgggtatcatagagtctatcgataatgattcacaggagcttactgttttatttgat
gatgataagcgggttgtttacgattttgcagatatagatgagttaagcctttcttactgt
gtgactgtccacaaaagccaaggaagtgaatttccggctgtcatcatgcctatgagcttt
ggaccgcctatgcttcttaccagaaaccttctgtatacggctgttacgagggctaaaaag
cttgtggtaatagttggccaagaaaaatacttaaaaagtatgatcgacaataatcttata
tcaaagaggtactcagggcttttacctaaacttatgaaagtccttaaattcatggtggaa
gaaaattga

DBGET integrated database retrieval system