KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2030Help
Entry
Thexy_2030        CDS       T01505                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Thexy_2030
  Lipid metabolism
   00561 Glycerolipid metabolism
    Thexy_2030
   00600 Sphingolipid metabolism
    Thexy_2030
Enzymes [BR:txy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Thexy_2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2110813..2113044)
Genome map
AA seq 743 aa AA seqDB search
MKIYYNETEKEFHLQNDYISYIIKIMKNNQLGHLYFGKRLNHRESFGHLMNVLPRAYTAY
VFKDDFKFSLDLLRQEYPSYGTTDFREPAYQVKQENGSIITNFEYQNHKIYNGKPKLDGL
PSTYTENDSEALTLEIWLKDNLIDMDLVLTYTIFEEYGVITRSARFINNGKQKLKLMRAM
SMSIDLPDADYDMIHLSGAWARERYIKLRRLQPGIQSVSSIRGASSAQQNPFIALKRSWA
TEDEGEVFGFNLIYSGNFLAQVEVDYDNVTRVIMGIHPFNFGWILDSGESFQTPEAVMVY
SDKGLNGMSQIFHKLYRNRLVRGKFRDEIRPILINNWEATYFNFDEKKILEIARTAKELG
IELFVLDDGWFGNRNDDSSSLGDWFENREKLPNGIKGLAEKITAMGMKFGLWIEPEMVNK
DSILYSQHPDWIIQVPGRRVSHGRNQYVLDFSRKEVVNHIYEMISKILREAPISYVKWDM
NRNITEPYSVALPPERQGEVFHRYILGVYSLYEKLTSEFPDILFESCAGGGGRFDPGMLY
YAPQAWASDNTDAVERLKIQYGTSICYPINAIGSHVSAVPNHQVGRITPIETRANVAYFG
TFGFELDLSQLTYEEKDKIKEQIKFFKKYRELIHKGTFYRINSPFEGDGNITSWMVVSED
LKEAIIGYYQVLAQPNQGLKKIRLKGLDTKYLYRIVGSSESYYGDELMYSGLPLDDFYLE
IFNRDKEDSADFMSKVYVIKAEE
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatttactataatgaaacagaaaaagaatttcatcttcagaacgattatataagc
tatataataaagataatgaaaaataatcagcttggacatttatattttgggaagagatta
aatcatagagaatcctttgggcatcttatgaatgtattgccaagagcatataccgcgtat
gtttttaaagacgattttaagttttctttagatttgttaagacaagaatatccatcttat
ggcacaacggattttcgagagcctgcatatcaagtaaagcaggaaaatgggagtataata
acaaattttgagtatcaaaatcataaaatatacaacggaaagccaaaacttgatgggctt
ccctcaacttatactgaaaatgattctgaagcgctaacattggagatatggctaaaagat
aatctaattgatatggatttagtattaacatataccatatttgaagagtatggagtaata
acaagaagtgccagatttataaacaatggtaagcagaagttaaaattgatgagggcaatg
agcatgagcattgatttaccagatgccgattatgatatgattcatttatcaggtgcatgg
gcacgagagagatatattaaacttcgcagacttcaaccagggatacagtctgtttcgagc
ataagaggtgcaagcagcgctcagcagaatccttttatagctctaaaacgttcttgggct
actgaagatgaaggagaagtatttggatttaacttaatatatagtgggaatttccttgca
caggtagaagttgactatgataacgtgacacgcgttattatgggaatacatccttttaat
tttggctggattctagattctggtgagagtttccaaacgcctgaagctgttatggtttat
tctgacaaaggactaaatggcatgagtcaaatttttcataagctttataggaatagatta
gtaagaggaaaatttagagacgaaattcgaccaatacttattaataattgggaagcaact
tattttaattttgatgaaaagaaaatattagaaatcgcaaggaccgcaaaagaattaggg
attgaactttttgtgttggatgatggatggtttggaaatagaaatgatgattcctcttca
ttaggagattggtttgaaaatagagagaagttacctaatggaataaaaggtttagcggaa
aaaataactgcaatgggaatgaaatttggactttggattgagccggaaatggttaataaa
gatagtattctttattctcagcatcctgattggataattcaagtaccaggaagaagagtt
tctcatggtagaaatcagtatgtacttgatttttctaggaaagaagttgtaaatcacata
tatgaaatgatttcaaaaatattgagggaagcacctatttcttatgtaaaatgggatatg
aacagaaatattacagaaccgtattctgttgcacttcctccagaaaggcaaggagaagta
tttcatagatatatattaggagtatattctctttatgaaaaattgacgtctgaatttcct
gatatattatttgagtcatgtgctggtggtggaggcagatttgatcctggaatgctttat
tatgctcctcaggcatgggcaagtgacaatacagatgcagttgagcgattaaaaatacaa
tatggcacttctatttgctatccaataaatgcaattggttcacatgtttcagcagtaccg
aatcaccaagttggtcgaattactcctattgaaacaagagctaatgtagcttactttggc
acatttggttttgagcttgatttaagtcagctaacatatgaagaaaaagacaaaataaaa
gagcaaataaaatttttcaaaaaatacagagaactaattcataaaggaactttttatcga
ataaatagtccttttgaaggtgatggaaatataacatcatggatggttgtttctgaagat
cttaaagaagcaattataggatattatcaagtattagcacaaccaaatcaaggattaaaa
aaaatacgtcttaagggacttgatacgaagtatttatacagaattgtaggtagttcagaa
agttattatggtgacgaattgatgtattctggattacctctagacgatttctatcttgaa
atatttaacagagacaaggaagatagtgcagactttatgtcaaaggtttatgtgataaaa
gcagaagaataa

DBGET integrated database retrieval system