KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2031Help
Entry
Thexy_2031        CDS       T01505                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Thexy_2031
  Lipid metabolism
   00600 Sphingolipid metabolism
    Thexy_2031
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Thexy_2031
Enzymes [BR:txy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Thexy_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2113058..2115307)
Genome map
AA seq 749 aa AA seqDB search
MREIIHINNNWYFKAKYEDGYEKVDDLEKFEIVNLPHTNVELPYNYFDEKMYQVKSCYKY
PLNISDEYRGKAIYLHFEGVMAYAQVYLNDLYIGEHKGGYTPFDVRIDEAYDWGRKVNIV
TVVVDSTERNDIPPFGGQIDYLTYGGIYREVSLGIYDDVFIKNTKVETHGIYDDEKSLNL
IVHLENLNQQSGNVKFKVKINEKNGKEVSYREFNTYVDAAKNVYSFNIENLRDIKLWDVD
NPNLYEIKVGMEINNFSDEYVDTFGFREAVFKPDGFYLNGKKLKLRGLNRHQSYPYVGYA
MPKRVQEKDAEILKNDLHLNIVRTSHYPQSKHFLNKCDELGLLVFEEIPGWQHIGNDEWK
KVAEENLREMIKRDWNHPSIILWGVRINESQDDDAFYKNMNKIAHEMDATRQTGGVRYIT
NSSFLEDVYTFNDFIHDGINKPLRKQQEVTGLEYNVPYLVTEYNGHMYPTKRFDNEERQM
EHCLRHLRVQNASYLDDNISGAIGWCAFDYNTHKDFGSGDRICYHGVMDMFRLPKFASYV
YKSQVSPDVEPVLEPVTFWARGERSIGGVIPLVIFTNCDYIELHYGSKTKIDKIYPNRVE
YKGIPYPPVIVDYSIIKPEEVGSWGMKWEDLYLRGFYKNNVVIERKFSTEPIPTQLYVMP
DDVLLDASQKDATRIVVKILDQYGNLLPFIDEVIKIEIEGPAKLQGPNEIALIGGAIAFW
VETINEGGVINIKVKSKSLGQKNVMIKVE
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattattcacattaataataattggtattttaaagcaaaatatgaggatggt
tacgaaaaagtagatgatttggagaaatttgaaatagtaaatctccctcatacaaatgta
gaactgccctataattattttgatgaaaagatgtatcaggttaaatcatgttacaagtat
ccacttaatatatcagacgagtatcgaggcaaagctatttatcttcattttgaaggagta
atggcatacgctcaagtttatttaaatgatttatatattggtgaacacaaaggtggatat
acaccgtttgatgttagaattgatgaagcttacgactggggtaggaaagtaaatatagtt
acggtcgttgttgattctactgagaggaatgatataccgccctttggaggccagatagat
tatttgacatatggggggatttatcgtgaagtaagcttaggaatatatgacgatgtattt
attaaaaatactaaagttgaaacacatgggatatatgatgacgaaaaaagcttaaatttg
attgtgcatttagaaaacttaaatcagcaaagtggaaatgtcaaatttaaggtaaaaata
aacgagaaaaatggcaaagaggtttcttatagagaatttaatacatacgtggatgcggca
aaaaacgtttattcttttaatattgaaaatttgagagatataaagttgtgggatgtcgat
aatccaaatttgtatgagattaaagtgggtatggaaataaataatttttccgatgaatat
gttgatacatttggttttcgagaagctgtttttaaaccggatggtttctacttaaatggt
aaaaaattaaaattaagaggattaaataggcatcaatcttatccttatgtaggttatgct
atgcctaaacgtgttcaggagaaagacgctgaaattctaaaaaatgatttacatttaaat
atagttcgtacatcacattatcctcaatctaaacattttttaaacaaatgtgatgagctt
ggattgcttgtatttgaagaaattcctggttggcagcatataggaaatgacgagtggaaa
aaagtcgcagaggaaaatttaagagaaatgattaagagagattggaaccatccttcaatt
attctttggggtgttaggataaatgaatctcaggatgatgatgctttttacaaaaatatg
aataagatagctcatgagatggatgctacaagacaaactggaggagttagatatataaca
aatagcagttttcttgaggatgtatatacatttaatgattttatacatgatggaattaat
aaaccattgaggaagcaacaagaagttacaggtcttgaatataatgtaccctatttggtg
acagaatataatggtcatatgtatccaactaaacgttttgataacgaggaaaggcagatg
gagcattgtctacgccatttaagggttcaaaatgcttcttatttagatgataatatttct
ggggcaattggttggtgtgcatttgactataatacacataaagattttggatctggagat
cgcatatgttatcatggagtaatggatatgtttagattgcccaagtttgcgtcatatgta
tacaaatctcaggtgtctccagatgtagaacctgtattggaacctgtgacattttgggcc
agaggtgaaagaagtatcggtggtgttataccgcttgttatatttactaattgtgattat
atagagttacattatggcagtaagacaaaaatagataagatatatcctaatagagttgag
tacaaaggcataccatatccgccagtgatagtagactattcaattataaagccagaagaa
gtaggttcttggggcatgaaatgggaagacctatatttaagaggattttataaaaacaat
gtagttattgaaagaaaattttctactgaacctataccaacacaattatatgttatgcct
gatgatgtattattggatgcttctcaaaaagatgccacgcgaatagttgttaaaatactt
gatcagtatggaaatcttttgccctttattgatgaagtaattaaaatagaaatagaaggt
cctgcgaagcttcaggggccaaatgaaatagcacttataggtggtgcaatagcattttgg
gttgaaactattaatgaaggtggtgtaattaatatcaaagtaaagtccaagtctttggga
caaaagaatgtaatgataaaagtcgaatga

DBGET integrated database retrieval system