KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2031Help
Entry
Thexy_2031        CDS       T01505                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:txy00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:txy00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:txy00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2113058..2115307)
Genome map
AA seq 749 aa AA seqDB search
MREIIHINNNWYFKAKYEDGYEKVDDLEKFEIVNLPHTNVELPYNYFDEKMYQVKSCYKY
PLNISDEYRGKAIYLHFEGVMAYAQVYLNDLYIGEHKGGYTPFDVRIDEAYDWGRKVNIV
TVVVDSTERNDIPPFGGQIDYLTYGGIYREVSLGIYDDVFIKNTKVETHGIYDDEKSLNL
IVHLENLNQQSGNVKFKVKINEKNGKEVSYREFNTYVDAAKNVYSFNIENLRDIKLWDVD
NPNLYEIKVGMEINNFSDEYVDTFGFREAVFKPDGFYLNGKKLKLRGLNRHQSYPYVGYA
MPKRVQEKDAEILKNDLHLNIVRTSHYPQSKHFLNKCDELGLLVFEEIPGWQHIGNDEWK
KVAEENLREMIKRDWNHPSIILWGVRINESQDDDAFYKNMNKIAHEMDATRQTGGVRYIT
NSSFLEDVYTFNDFIHDGINKPLRKQQEVTGLEYNVPYLVTEYNGHMYPTKRFDNEERQM
EHCLRHLRVQNASYLDDNISGAIGWCAFDYNTHKDFGSGDRICYHGVMDMFRLPKFASYV
YKSQVSPDVEPVLEPVTFWARGERSIGGVIPLVIFTNCDYIELHYGSKTKIDKIYPNRVE
YKGIPYPPVIVDYSIIKPEEVGSWGMKWEDLYLRGFYKNNVVIERKFSTEPIPTQLYVMP
DDVLLDASQKDATRIVVKILDQYGNLLPFIDEVIKIEIEGPAKLQGPNEIALIGGAIAFW
VETINEGGVINIKVKSKSLGQKNVMIKVE
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattattcacattaataataattggtattttaaagcaaaatatgaggatggt
tacgaaaaagtagatgatttggagaaatttgaaatagtaaatctccctcatacaaatgta
gaactgccctataattattttgatgaaaagatgtatcaggttaaatcatgttacaagtat
ccacttaatatatcagacgagtatcgaggcaaagctatttatcttcattttgaaggagta
atggcatacgctcaagtttatttaaatgatttatatattggtgaacacaaaggtggatat
acaccgtttgatgttagaattgatgaagcttacgactggggtaggaaagtaaatatagtt
acggtcgttgttgattctactgagaggaatgatataccgccctttggaggccagatagat
tatttgacatatggggggatttatcgtgaagtaagcttaggaatatatgacgatgtattt
attaaaaatactaaagttgaaacacatgggatatatgatgacgaaaaaagcttaaatttg
attgtgcatttagaaaacttaaatcagcaaagtggaaatgtcaaatttaaggtaaaaata
aacgagaaaaatggcaaagaggtttcttatagagaatttaatacatacgtggatgcggca
aaaaacgtttattcttttaatattgaaaatttgagagatataaagttgtgggatgtcgat
aatccaaatttgtatgagattaaagtgggtatggaaataaataatttttccgatgaatat
gttgatacatttggttttcgagaagctgtttttaaaccggatggtttctacttaaatggt
aaaaaattaaaattaagaggattaaataggcatcaatcttatccttatgtaggttatgct
atgcctaaacgtgttcaggagaaagacgctgaaattctaaaaaatgatttacatttaaat
atagttcgtacatcacattatcctcaatctaaacattttttaaacaaatgtgatgagctt
ggattgcttgtatttgaagaaattcctggttggcagcatataggaaatgacgagtggaaa
aaagtcgcagaggaaaatttaagagaaatgattaagagagattggaaccatccttcaatt
attctttggggtgttaggataaatgaatctcaggatgatgatgctttttacaaaaatatg
aataagatagctcatgagatggatgctacaagacaaactggaggagttagatatataaca
aatagcagttttcttgaggatgtatatacatttaatgattttatacatgatggaattaat
aaaccattgaggaagcaacaagaagttacaggtcttgaatataatgtaccctatttggtg
acagaatataatggtcatatgtatccaactaaacgttttgataacgaggaaaggcagatg
gagcattgtctacgccatttaagggttcaaaatgcttcttatttagatgataatatttct
ggggcaattggttggtgtgcatttgactataatacacataaagattttggatctggagat
cgcatatgttatcatggagtaatggatatgtttagattgcccaagtttgcgtcatatgta
tacaaatctcaggtgtctccagatgtagaacctgtattggaacctgtgacattttgggcc
agaggtgaaagaagtatcggtggtgttataccgcttgttatatttactaattgtgattat
atagagttacattatggcagtaagacaaaaatagataagatatatcctaatagagttgag
tacaaaggcataccatatccgccagtgatagtagactattcaattataaagccagaagaa
gtaggttcttggggcatgaaatgggaagacctatatttaagaggattttataaaaacaat
gtagttattgaaagaaaattttctactgaacctataccaacacaattatatgttatgcct
gatgatgtattattggatgcttctcaaaaagatgccacgcgaatagttgttaaaatactt
gatcagtatggaaatcttttgccctttattgatgaagtaattaaaatagaaatagaaggt
cctgcgaagcttcaggggccaaatgaaatagcacttataggtggtgcaatagcattttgg
gttgaaactattaatgaaggtggtgtaattaatatcaaagtaaagtccaagtctttggga
caaaagaatgtaatgataaaagtcgaatga

DBGET integrated database retrieval system