KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2211Help
Entry
Thexy_2211        CDS       T01505                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:txy00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:txy00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2311091..2313511)
Genome map
AA seq 806 aa AA seqDB search
MRKVIILLFIFIFTISAILTGCSEKININEDKISHKIDIPDSAWTIGIGEKFKNAGHPNV
KYPMIDDSYVQGAPLGGFGAGTIGRTYNGGFSRWHLEIGKNKYTTVYANQFSVFQKVEGN
KDGVAQVLYAGEPENGYLSSWKWDYPKESGMYYALYPNSWYTYTNKDLPVQLAVKQFSPI
IPYNYKETSYPVAVFKWTAYNPTNKNVDVSIMFTWQNMIGFFGKQVNVNSGNFNKIIKDK
SKDSEIVAAVMGNISNDNEEWNGEYSIGVKKVPGVDISYKAKFVTTGDGSDLWHEFSKNG
ILDNKDDETPTKQDGIGSAIAVNFKLQPGQTIEVPFALSWDLPIMKFGGGDKWYKMYTKY
FGKNGKNSFAILKEALNNYQKWEKMIDDWQKPILSNKSKPDWYKTALFNELYYLADGGTA
WENGKVGEKDKRTNNMFGLLECFDYNYYETLDVRFYGSFPLVMLWPDIEKQVMRQFADTI
NVQDSSEFKVGSNGAMAVKKVQGMIPHDLGSSYALPWIKINAYDWQNPNIWKDLNSKYVL
LVYRDYVLTGKTDKEFLKYTWKSVKTALDKLKEMDKDNDGIPDNEGIPDQTYDTWSMKGT
SAYCGSLWLAALKAAQEIGKVLKDNEAYIKYNEWYKIAQQNFEKELWNGEYYNFDTESDH
KDSIMADQLAGQWYADILRLGDILPKDHVQKALKKIYEFNVMKFENGKMGAVNGMRPDGI
VDESDIQAQEVWTGVTYALASFMKYRGMTEEAYNTAYGVYKMTYDKSGKGYWFRTPEAWT
KDGNYRASMYMRPLSIWSMEVNYNEV
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtaataatattgttatttatttttatatttacaattagtgcaatactaaca
ggatgttcagaaaaaattaacataaatgaagacaaaataagtcataaaatagatatacca
gatagtgcgtggacaataggcataggtgagaaatttaaaaatgcaggtcatccaaatgtt
aaatacccaatgattgatgattcatatgtacaaggagctccacttggtggatttggggct
ggcacaataggaaggacatataacggtgggttttcaagatggcaccttgaaataggcaaa
aacaaatatactacggtttatgctaatcagtttagcgtatttcagaaggttgaaggaaat
aaagatggtgtggcacaggtactatatgcgggcgaaccggaaaacggctatcttagcagc
tggaaatgggattatccaaaggaaagtggaatgtattatgcgttatatcctaattcatgg
tatacatacactaacaaagatttgcctgtacaacttgcggtaaagcagttttctcctata
ataccttataattataaagaaacatcataccctgttgctgtttttaaatggactgcatat
aacccaacaaataaaaatgtcgacgtttctataatgtttacatggcaaaatatgattggt
ttttttggtaaacaagtaaatgtcaatagtggcaacttcaataaaattattaaagacaaa
tctaaagatagtgagattgttgcggctgttatgggcaatatatcaaacgataatgaagaa
tggaatggagaatattcaattggtgttaaaaaagttccgggcgttgatatttcatataaa
gctaaatttgtaactactggtgatggtagcgacttatggcatgaattttcgaaaaatggg
attcttgataataaagatgacgaaaccccaacaaaacaggatggaataggcagtgcaata
gcagttaactttaaattgcaacccggacaaacaattgaggtaccatttgctttaagttgg
gatttgccaataatgaaatttggtggcggcgataaatggtataaaatgtatacaaagtat
tttggaaaaaacgggaaaaattcttttgcaattttaaaagaggcattaaataattatcaa
aagtgggaaaagatgatagatgactggcaaaagccaatattatcaaataagagtaaaccc
gactggtataaaactgctttgtttaatgaactttattatcttgctgatggcgggacagct
tgggaaaatggtaaagttggggaaaaagataaaagaacaaacaacatgtttggccttttg
gagtgttttgactataactattatgagacacttgatgtaaggttttatggttcgtttccg
cttgtaatgttgtggccggatatagaaaaacaggttatgagacagtttgctgatactata
aatgtgcaggatagttcagagtttaaagttggctcgaacggagcaatggcagtaaaaaag
gttcaaggcatgataccgcatgatctaggttcttcatatgctctgccttggataaagatt
aatgcatatgattggcagaatccaaatatctggaaagatttaaattctaaatatgtgctt
cttgtgtacagagattatgtcctgactggaaaaacagataaagaatttttgaaatacaca
tggaaatcagtaaagaccgctcttgataaattaaaagaaatggataaagacaacgacggt
ataccagataatgaaggtatacctgaccagacgtatgatacttggtcaatgaaaggaaca
agtgcatattgtgggagtctctggcttgctgctttaaaggcagcgcaggaaataggaaaa
gttttaaaagataatgaagcatatataaaatacaatgaatggtataaaattgctcaacaa
aactttgaaaaagaattgtggaatggtgagtattacaattttgatacagagagcgaccat
aaagatagtattatggcggatcaacttgctggtcagtggtatgcggatatattaagatta
ggagatatattgccaaaagatcatgtgcaaaaagccttaaagaaaatatatgaatttaat
gttatgaaatttgaaaatggtaagatgggtgcagtaaatggtatgaggccggacggtata
gttgatgagtccgatatacaggcacaggaagtttggacaggtgtgacatatgctttagca
tcttttatgaaatacagaggtatgacagaagaagcgtataacacagcatatggagtatat
aaaatgacttatgataaaagtggaaagggctattggttcaggactcctgaagcatggacc
aaggacggaaattatagagcttcaatgtatatgaggccgctttctatatggtctatggag
gtaaattataatgaagtttaa

DBGET integrated database retrieval system