KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2262Help
Entry
Thexy_2262        CDS       T01505                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thexy_2262
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thexy_2262
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thexy_2262
Enzymes [BR:txy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thexy_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2372254..2373312)
Genome map
AA seq 352 aa AA seqDB search
MMEWDGIIKSYRRYMPKIDDENIITLKEGNTPLIEAENIEKDFPGLKIYLKYEGLNPTGS
FKDRGMTVAVSMAKQEGSQAVVCASTGNTSASAAAYASKAGLKCVVLIPGGKIALGKLAQ
AIAYGAEVVAINGNFDDALNLVREISKMHPITVVNSINPYRLEGQKSSSFEICDTLKKAP
DYLALPVGNAGNITAYWMGFKEYYCNGMIDSLPKMIGFQAAGAAPIVENRVFEHPETIAT
AIRIGNPASWQKAVAARDESGGLIDKVTDDEILEAYSYLAKREGIFAEPASCASIAGVIK
KYREGLFKEGDTVVCVLTGNGLKDPDTAINLGGKSVKTVDADLKSLEGAIYG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgatggaatgggatggaataataaagtcgtatagaagatacatgcctaaaatagacgat
gagaatataatcacgctaaaagaaggaaacacaccccttatagaagctgaaaacatcgag
aaggattttccggggttaaagatctatttaaagtacgaaggtttaaatccgacaggctct
tttaaagatagaggcatgacggtagccgtatcaatggcaaagcaggaaggctcgcaggct
gtcgtgtgtgcatcaacaggcaatacatccgcatcggcggctgcttatgcatcaaaagcc
ggacttaaatgcgtcgttctgattccaggtggaaagatagcgttaggaaaattagctcag
gcaatagcgtatggtgcagaagtcgtcgccataaacggcaattttgatgatgcattaaac
cttgtgagggagatatcgaaaatgcaccctataaccgtagtaaattccataaacccgtac
agattggaagggcagaaatcatcgtcgtttgaaatatgcgatacgcttaagaaggctcct
gattatctggcacttcctgttggcaatgcgggaaatattacggcgtattggatgggcttt
aaagagtattactgcaatggcatgatcgacagtctgcctaagatgataggatttcaagcg
gcaggcgcagcccctatcgtggaaaatagggtatttgagcaccctgagacgatagcaaca
gccataagaattggaaacccagccagttggcagaaagccgttgcagcaagggacgaatca
ggtggccttatagataaggtgacggacgatgagatattagaggcgtactcgtaccttgcc
aagagggaagggatctttgcagagcctgcctcatgtgcttctattgcaggcgtcataaag
aagtacagagagggtcttttcaaagagggtgatactgtcgtgtgcgtcttgacaggaaat
gggcttaaagatcctgatacagccataaacttaggcgggaaaagcgtaaagactgtggat
gctgacttaaaatcattggaaggtgcaatatatggttaa

DBGET integrated database retrieval system