KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2304Help
Entry
Thexy_2304        CDS       T01505                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy00010  Glycolysis / Gluconeogenesis
txy00260  Glycine, serine and threonine metabolism
txy00680  Methane metabolism
txy01100  Metabolic pathways
txy01110  Biosynthesis of secondary metabolites
txy01120  Microbial metabolism in diverse environments
txy01130  Biosynthesis of antibiotics
txy01200  Carbon metabolism
txy01230  Biosynthesis of amino acids
Module
txy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
txy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_2304
  Energy metabolism
   00680 Methane metabolism
    Thexy_2304
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thexy_2304
Enzymes [BR:txy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Thexy_2304
Membrane trafficking [BR:txy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Thexy_2304
Exosome [BR:txy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Thexy_2304
  Exosomal proteins of melanoma cells
   Thexy_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEF18306
JGI: Thexy_2304
UniProt: F6BLV5
Position
2419344..2419907
Genome map
AA seq 187 aa AA seqDB search
MTKVYFVRHCKPDFSIKDDLMRPLTKDGQKDCKKVTEFLSDKNISKIFSSPYKRAIDTIK
DFAESANLKINVIDDFKERKIGNAWIEDFDKFAKEQWHNFNYKLPGGESLNDVQRRNIKA
LMNILEENVNHNIAISSHGTALSTIINYFNKKFDYAEFEKIKDLMPFIVCFTFDGQDILN
IEKFIFD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtatattttgtaagacattgtaaaccagatttttcaattaaagatgattta
atgcgtccactcactaaagatggtcaaaaagactgcaaaaaagttacagaatttttgtca
gataaaaatatttcaaagatattttcaagtccttataaaagagccattgacactataaaa
gattttgcagaaagtgcaaacttaaagattaatgttattgacgattttaaagaaagaaag
attggcaatgcctggatagaagattttgataaatttgcaaaagaacaatggcataatttt
aattataaattgcctgggggagaaagtttaaatgatgttcaaaggagaaatataaaagca
cttatgaatatacttgaagaaaatgtgaatcataatattgcgatatcttctcatggaact
gctttaagtacgataataaattattttaataaaaaattcgattatgctgaatttgaaaaa
atcaaagatcttatgccatttattgtttgttttactttcgatggccaagatattttgaat
atcgaaaaatttatttttgactaa

DBGET integrated database retrieval system