KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2304Help
Entry
Thexy_2304        CDS       T01505                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thexy_2304
   01230 Biosynthesis of amino acids
    Thexy_2304
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_2304
  Energy metabolism
   00680 Methane metabolism
    Thexy_2304
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thexy_2304
Enzymes [BR:txy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Thexy_2304
Exosome [BR:txy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Thexy_2304
  Exosomal proteins of melanoma cells
   Thexy_2304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2419344..2419907
Genome map
AA seq 187 aa AA seqDB search
MTKVYFVRHCKPDFSIKDDLMRPLTKDGQKDCKKVTEFLSDKNISKIFSSPYKRAIDTIK
DFAESANLKINVIDDFKERKIGNAWIEDFDKFAKEQWHNFNYKLPGGESLNDVQRRNIKA
LMNILEENVNHNIAISSHGTALSTIINYFNKKFDYAEFEKIKDLMPFIVCFTFDGQDILN
IEKFIFD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtatattttgtaagacattgtaaaccagatttttcaattaaagatgattta
atgcgtccactcactaaagatggtcaaaaagactgcaaaaaagttacagaatttttgtca
gataaaaatatttcaaagatattttcaagtccttataaaagagccattgacactataaaa
gattttgcagaaagtgcaaacttaaagattaatgttattgacgattttaaagaaagaaag
attggcaatgcctggatagaagattttgataaatttgcaaaagaacaatggcataatttt
aattataaattgcctgggggagaaagtttaaatgatgttcaaaggagaaatataaaagca
cttatgaatatacttgaagaaaatgtgaatcataatattgcgatatcttctcatggaact
gctttaagtacgataataaattattttaataaaaaattcgattatgctgaatttgaaaaa
atcaaagatcttatgccatttattgtttgttttactttcgatggccaagatattttgaat
atcgaaaaatttatttttgactaa

DBGET integrated database retrieval system