KEGG   Thermoanaerobacterium xylanolyticum: Thexy_2316Help
Entry
Thexy_2316        CDS       T01505                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:txy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thexy_2316
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thexy_2316
   00620 Pyruvate metabolism
    Thexy_2316
   00650 Butanoate metabolism
    Thexy_2316
  Lipid metabolism
   00071 Fatty acid degradation
    Thexy_2316
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thexy_2316
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thexy_2316
   00626 Naphthalene degradation
    Thexy_2316
Enzymes [BR:txy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thexy_2316
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Thexy_2316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2426070..2428649
Genome map
AA seq 859 aa AA seqDB search
MATTKTELDVQKQIDLLVSRAQEAQKKFMSYTQEQIDAIVKAMALAGVDKHVELAKMAYE
ETKMGVYEDKIIKNLFATEYVYHDIKNEKTVGIINENIEENYMEVAEPIGVIAGVTPVTN
PTSTTMFKCLISIKTRNPIIFSFHPKAIKCSIAAAKVMYEAALKAGAPEGCISWIETPSI
EATQLLMTHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIEKSANIKRAVSDLI
LSKTFDNGVICASEQAVIIDEEIADEVKKLMKEYGCYFLNKDEIKKLEKFAIDEQSCAMS
PAVVGQPATKIAEMAGFKVPEGTKILVAEYEGVGPKYPLSREKLSPILACYTVKDYNEGI
KKCEEMTEFGGLGHSAVIHSENQDVINEFARRVRTGRLIVNSPSSQGAIGDIYNTNTPSL
TLGCGSMGRNSTTDNVSVNNLLNIKRVVIRKDRMKWFKIPPKIYFESGSLQYLCKVKRKK
AFIVTDPFMVKLGFVDKVTYQLDKANIDYEIFSEVEPDPSVDTVMNGVKIMNSYNPDLII
AVGGGSAIDAAKGMCLFYEYPDTEFETLRLKFADIRKRAFKFPELGKKALFIAIPTTSGT
GSEVTAFAVITDKKRNIKYPLADYELTPDIAIIDPDLTKTVPPSVTADTGMDVLTHAIEA
YVSVMASDYTDALAEKAIKIVFEYLPRAYKNGNDEEAREKMHNASCMAGMAFTNAFLGIN
HSMAHILGGKFHIPHGRANAILLPYVIRYNAEKPTKFVAFPQYEYPKAAERYAEIAKFLG
LPASTVEEGVESLIEAIKNLMKELNIPLTLKDAGINKEQFEKEIEEMSDIAFNDQCTGTN
PRMPLTKEIAEIYRKAYGA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgacaaaaacggaattagacgttcagaagcagatagatttacttgtatcaaga
gcacaagaggctcaaaaaaaattcatgtcttatacacaagagcaaatcgacgcaatcgta
aaggcaatggctttagcaggtgtagacaaacacgtagagctggcaaagatggcatacgaa
gagacaaaaatgggtgtgtacgaagataagattataaaaaatctctttgccacagagtac
gtataccacgacataaaaaatgaaaagactgtaggaatcataaacgaaaacatagaagaa
aactacatggaagtagcagagccgataggcgtaattgccggtgtcacacctgtcacaaac
ccgacatctactacgatgtttaaatgcttaatatccataaagacgcgaaaccccataata
ttcagcttccatccaaaggcaataaagtgcagcatcgcagcagcaaaagtcatgtacgaa
gctgcattaaaggcaggtgcacctgaaggatgcataagctggatagaaacgccatcgata
gaagccacacagcttctcatgacacatccaggcgtatctttaatccttgcaacaggtggt
gcaggaatggtaaaagcagcatacagctcaggaaagccagcattaggcgtaggtcctggc
aacgtgccatgctacattgagaaatcagcaaacataaaaagagctgtatcagacctcata
ttaagcaagacatttgacaatggagtaatatgcgcatcagagcaggctgtaataatagat
gaagaaatagcagatgaagtcaaaaaacttatgaaagagtacggctgctacttcctaaat
aaagatgaaatcaagaagcttgaaaaattcgcaatcgacgagcaaagctgtgctatgagc
cctgcagtggtaggtcagccagccacgaagattgccgagatggcaggcttcaaagttcct
gaaggcacaaagatattagtggcagaatacgaaggagtaggtccaaaatatcctctatca
agggagaaactaagtccaattcttgcttgctacactgtcaaagattacaacgaaggaatc
aaaaagtgcgaggaaatgactgaatttggaggtttaggccactccgctgtaatacactct
gaaaaccaagacgtcataaatgaatttgcaagacgagtccgcacaggaagacttatcgta
aattcaccatcatcacagggagcaataggagatatatataatacaaacacgccatcactt
acattaggctgcggttctatgggaagaaactcaacaacagacaatgtaagtgtcaacaat
cttttgaatattaagcgtgtcgtgataaggaaggatagaatgaaatggttcaagattcca
ccaaagatttactttgaaagcgggtcactgcagtatttatgcaaggtcaaaaggaaaaag
gcctttatcgtcacagatccattcatggttaaacttggcttcgtagacaaagtaacttat
caattagacaaggcaaacatcgactacgaaatattctcagaagttgagccagatccatct
gttgacacagtcatgaacggcgtaaaaataatgaattcatacaatccagacttaataatc
gctgtaggcggtggttctgcaatagatgcagcaaagggaatgtgtcttttctacgaatat
cctgacacagagtttgaaacattgaggcttaaattcgctgatataagaaagagagcattt
aagttcccagagcttggcaaaaaagcgctgttcatcgcaataccgacaacaagcggtaca
ggctcagaagtgacagcatttgccgtaataaccgacaaaaagagaaatatcaagtaccca
cttgcagactatgaacttacacctgatatagccataatagatcctgaccttacaaagaca
gtgccaccatctgtaacagcagatacaggtatggatgtgttgacacacgccatagaagca
tacgtgtcagtgatggcatcagactacacagatgcgctggcagaaaaggccataaagatc
gtatttgagtacctgccaagagcttataaaaacggcaatgatgaagaagcccgcgaaaag
atgcacaatgcttcctgtatggctggtatggcatttacaaatgcattccttggaataaac
cacagcatggcacacatactgggcggcaagttccacataccacacggaagagcaaatgca
atacttctgccatatgtaataagatacaatgcagaaaagcctacaaaatttgtggcattc
ccacagtacgaatatccaaaggcagcagaaagatatgcagaaatcgccaaattcttagga
ctgcctgcatcaaccgttgaagaaggcgtagaaagcttgatcgaagctataaagaatctc
atgaaagagcttaacattccgctgactctaaaagacgctggcataaacaaagaacaattc
gaaaaagaaatcgaagaaatgtcggacatcgccttcaacgatcagtgcacaggaacaaat
ccaagaatgcctctcacaaaagaaattgcagagatctacagaaaagcatacggtgcataa

DBGET integrated database retrieval system