KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0084Help
Entry
THEYE_A0084       CDS       T00775                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THEYE_A0084
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THEYE_A0084
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THEYE_A0084
Enzymes [BR:tye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THEYE_A0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(89005..90357)
Genome map
AA seq 450 aa AA seqDB search
MRRILLSEKDLPMQWYNIQADMPKLPPPPLNPQTKKPISADDLKVIFPISLIEQEISTQR
WINIPEEVLNIYASFRPTPLYRAIGLEKALQTPAKIYFKHEGLGPAGSHKTNTSIPQAYY
NKIEGIKRIATETGAGQWGSALSLAGALMGIEITVYMVRVSYDQKPYRRIMMETWGGKVY
PSPSDKTESGRRILRENPDHPGTLGIAISEAVEDAATHKDTNYALGSVLNHVLLHQTIIG
LECKKQLEIAGDYPDIVIGCCGGGSNLGGVSFPFLYDKIHGKEVRVIAVEPSSCPTLTKG
EFRYDYGDTAGLTPFLMMYTLGHDFVPPGIHAGGLRYHGDSPLVSQLCHDGLIEAVAVGQ
TAVFESAILFARSEGIIPAPESAHAIKVAIDEALKAKEEGKRKVILFNLSGIGFLDLPSY
EAYLSGKLTDFEYPDEKIKESLSQLPEIKL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaattttactttcagaaaaagatttaccaatgcaatggtataatatacaggct
gatatgcctaagttaccgccaccaccccttaatcctcaaactaaaaagcctatatctgca
gatgatttaaaagtaatatttcccatatctcttattgaacaagaaataagcactcaaaga
tggataaacattcctgaagaagttttaaatatttacgcaagctttagaccaacacctctt
tacagagctattggacttgaaaaagctcttcagactcctgcaaagatttatttcaaacat
gaaggacttggtcctgcaggaagccataaaacaaatacctctatacctcaggcttattac
aacaagattgaaggaataaaaagaattgctacagaaacaggtgcaggacaatggggttca
gcactttccttggcaggagcattgatgggcatagagataacagtttatatggtaagagtt
agttatgaccagaagccttacagaagaataatgatggaaacatggggaggaaaggtttat
ccatctccttctgataaaactgaatcaggtagaagaattctcagagaaaatccagaccac
cctggaacacttggtatagcaatatctgaggcggttgaagatgcagcaacccataaagat
acaaattacgcacttggttcggtgctaaatcatgttttacttcatcagacaattattggg
cttgaatgcaaaaaacaacttgaaattgcaggagattatcctgatattgtaatcggttgc
tgtggaggaggaagcaatcttggcggagtcagtttcccatttctttatgataaaattcat
ggaaaggaagtaagagttatagcagttgaaccctcaagctgtccaacacttacaaaggga
gagttcagatatgactatggtgacacagctggacttacgccttttcttatgatgtataca
cttgggcatgactttgtacctccgggaattcatgcaggaggattgagatatcatggagac
tcacctcttgtgagtcaactctgccatgatggattaattgaagcagtagcagtaggacaa
actgctgtttttgaatctgctatactttttgcaagaagcgaaggaataattcctgcacct
gaaagtgctcatgccataaaagttgcaatagatgaagctctgaaagcaaaagaagagggc
aaaagaaaagtaatactctttaatttaagtggcataggctttcttgacctgccctcttat
gaagcatatttatctggtaagcttactgattttgaatatcctgatgaaaaaataaaagaa
tctctatctcaattgccagagattaagttgtag

DBGET integrated database retrieval system