KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0226Help
Entry
THEYE_A0226       CDS       T00775                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose-5-phosphate synthase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THEYE_A0226 (dxr)
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     THEYE_A0226 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229494..230639)
Genome map
AA seq 381 aa AA seqDB search
MKKVVILGSTGSIGKNALEVIRKFPDKFKVLGLAAKSSVNILEEQIKEFNPQYVAVFDKK
ACDELRKKVKNLEILKGNEGICKLAKLKEADIILSAIVGAAGLIPTFEAVKEGKTIGVAN
KESFVMAGELIKKQGKISGAKIIPVDSEHSAVFQCINGCNKPYIKKIWLTASGGPFRGKK
SYEIENVTPQEALNHPKWKMGKRITIDSATLMNKGFEVIEAHYLFDMPAENIGVLIHPQS
IIHCLVEFIDGTYLAQMSNPDMKAPIALALSFPERLPEIVPPIDWSITTKLQFEIPDTEV
FPCLKLAYEALNAGGSMPAVLNAADEVAVEAFLSGRLKFKEIYKIIKKVMDAHKIVSVSS
IEEVLEADSWARKMAKKEIGE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaggttgttatacttggcagtacaggttcaataggaaaaaacgctcttgaagta
ataagaaaattcccagataaatttaaagtattaggacttgctgcaaaaagcagtgttaat
attctggaagaacagattaaagaatttaaccctcaatatgtagcagtatttgataaaaaa
gcctgtgacgaattaaggaaaaaagtcaaaaatttagaaatacttaaaggaaatgaagga
atttgtaaacttgcaaaactaaaagaagcagatataattctttcagctatagtaggtgct
gcaggtcttatccctacttttgaagcagtaaaagaaggaaaaacaataggagttgccaat
aaagaaagctttgtaatggcaggtgagttaataaaaaaacaagggaaaataagtggagca
aaaattattcctgttgacagtgaacatagtgcagttttccaatgcatcaatggttgtaat
aaaccctatataaagaaaatttggcttacagcatcaggtggtccgtttagaggcaaaaaa
agctatgaaatagaaaatgttactcctcaagaggctttaaatcatccaaagtggaaaatg
gggaaaagaataacaattgattcagcgactcttatgaataaaggttttgaagtaattgaa
gcgcactatctttttgatatgcccgcagaaaatattggtgttttgattcatccacagagt
attattcactgtcttgttgaatttattgacggaacatatcttgctcagatgagtaatcct
gatatgaaagcacctattgcacttgcgctttcctttcctgaaagacttccagagattgtt
ccaccaatagactggagtatcacaactaagctacaatttgaaattccagatacagaagtt
ttcccttgccttaaacttgcctatgaagcattgaatgcaggagggagcatgccagcagtt
ttaaatgcagcagatgaagtagctgttgaagcttttctgtctggaaggttaaaatttaaa
gagatatataaaataataaaaaaagtcatggatgcccacaaaattgtttctgtcagcagt
atagaagaagttcttgaagctgatagctgggcaagaaaaatggcaaaaaaggagattgga
gaatga

DBGET integrated database retrieval system