KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0432Help
Entry
THEYE_A0432       CDS       T00775                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tye01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tye00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(417571..418668)
Genome map
AA seq 365 aa AA seqDB search
MRIVVKIGSNLLTDKAGRINQKRILSLAKEVSELHNKSIEVVMVSSGAIASGLRKLGLKT
KPREIRKKQATAAVGQPLLMWMYERSFLKYKKHIAQILLTRDDLSDRIRYVNAKNTILTL
LEMDVIPIINENDTVATDEIKFGDNDQLAALVSGLIEANHLIILSDVEGLYTSDPKKDPD
AKIIKHVKEVSKELIEIAKPTSTGYGTGGMYSKVMAAKKATSFGIPVHIVSGRSYGNIKA
VIEGKQIGTYFEPVAQKVTSRKGWIAYATRAKGNLYIDEGAVKALLKNGKSLLPSGIKKV
EGDFDVGDAVYCVDEKGERIAKGLVNYSSCEIKLIKGKKSSEIEKILGYKYSDEIVHRDN
LVILI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcggattgttgtaaaaatagggagtaatcttttaactgacaaagcaggacgcattaac
caaaaaagaattctttctttggcaaaggaagtttccgaacttcataataaatcaattgaa
gttgtgatggtttcctccggagcaattgcttctggcttaaggaaactcggacttaaaact
aaacccagagaaataagaaaaaaacaggctacagctgctgttggacaacctcttcttatg
tggatgtatgaaaggtcttttcttaaatataaaaaacatatagctcagattcttcttaca
agagatgacctcagtgatagaattcgctatgttaatgcaaaaaatacgattcttacactt
cttgagatggatgttattcctataataaatgaaaacgacactgttgctacagatgaaata
aaatttggtgataatgaccagcttgcagcacttgtttcagggcttattgaagcaaatcat
ttgataattttatcagatgttgaaggactctatacatctgatcctaaaaaagaccctgat
gctaagataataaaacatgttaaagaggtttcaaaagaacttatagagatcgccaaacca
acaagcacaggatacggaacaggtggcatgtactcaaaagttatggctgcaaagaaagca
acctcatttggaatccctgttcatattgtaagcggaagaagctatggaaatattaaagct
gtaatagaaggaaaacagataggcacatactttgaaccagtagctcaaaaagtaacatcc
agaaaaggctggattgcctatgcaacaagagcaaaaggtaatctttatattgatgaaggc
gctgttaaagcattacttaaaaacgggaaaagtcttttaccatcaggaataaaaaaagtt
gaaggagattttgatgttggtgatgcagtatattgtgttgatgaaaaaggagaaagaatt
gcaaaaggattggttaactattcctcctgtgaaataaaactcataaaaggcaaaaaatct
tcagaaattgaaaaaattctcggatataaatactcagatgaaatagtccacagagataat
cttgttatccttatataa

DBGET integrated database retrieval system