KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0560Help
Entry
THEYE_A0560       CDS       T00775                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subuit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THEYE_A0560 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THEYE_A0560 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THEYE_A0560 (trpA)
Enzymes [BR:tye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THEYE_A0560 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(547805..548584)
Genome map
AA seq 259 aa AA seqDB search
MKQGFAVRKKIEEIKNQGKKAFIPYIMAGDPNLEETAKRLKILEQAGADLIELGVPFSDP
LADGPTIQKAAERALNSGTTLRKILNFLEDFKKSINTPIILMTYLNPVFCYGIERFFHDA
KGVNVGGVIFPDLTVEESKYYRTFAKKYGIDTIFLVAPTSTPERVKKIVKASTGFVYYVS
ITGITGTTLSLDKSFNDHINFVKSFGKPVCVGFGVSKPEEAKYISRIADGVIVGSAIVKI
FHEKPEKASEFIKSLREAI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggattcgcagttagaaaaaaaattgaagagataaaaaatcagggtaaaaaa
gcctttattccatatattatggcaggagacccaaatcttgaggaaactgcaaagagacta
aaaatacttgaacaggcaggagcagacctaatagagcttggcgttcccttttcagatcct
cttgctgatggaccgacaatacaaaaagcagcagaaagagcattaaactctggaacaacc
ttacgtaagatattgaattttcttgaggattttaaaaaaagtattaatacacccataatt
cttatgacttatttaaatcctgttttctgttacggaattgaaagattttttcatgatgca
aagggagtaaatgttggtggagttatttttcctgatctaacagttgaagagtctaagtat
tacagaacatttgcgaagaaatacggtattgatacaatatttcttgtagcaccaacatca
actcctgagagagtaaagaaaattgtaaaagcctcaacaggttttgtttactatgtttca
ataacaggaataacaggcactacacttagccttgataaatctttcaatgaccatataaat
tttgtaaaaagttttggaaaacctgtttgtgtaggctttggagtcagtaaaccagaagaa
gcaaaatatatttctcgaattgctgatggagtaattgtgggaagtgcaattgtaaaaatt
tttcatgaaaaacctgaaaaggcttctgaattcattaaatctctcagagaggcaatataa

DBGET integrated database retrieval system