KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0560Help
Entry
THEYE_A0560       CDS       T00775                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subuit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00260  Glycine, serine and threonine metabolism
tye00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tye01100  Metabolic pathways
tye01110  Biosynthesis of secondary metabolites
tye01130  Biosynthesis of antibiotics
tye01230  Biosynthesis of amino acids
Module
tye_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THEYE_A0560 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THEYE_A0560 (trpA)
Enzymes [BR:tye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THEYE_A0560 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA ALF NanE ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 6942017
NCBI-ProteinID: YP_002248403
UniProt: B5YJI8
Position
complement(547805..548584)
Genome map
AA seq 259 aa AA seqDB search
MKQGFAVRKKIEEIKNQGKKAFIPYIMAGDPNLEETAKRLKILEQAGADLIELGVPFSDP
LADGPTIQKAAERALNSGTTLRKILNFLEDFKKSINTPIILMTYLNPVFCYGIERFFHDA
KGVNVGGVIFPDLTVEESKYYRTFAKKYGIDTIFLVAPTSTPERVKKIVKASTGFVYYVS
ITGITGTTLSLDKSFNDHINFVKSFGKPVCVGFGVSKPEEAKYISRIADGVIVGSAIVKI
FHEKPEKASEFIKSLREAI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaggattcgcagttagaaaaaaaattgaagagataaaaaatcagggtaaaaaa
gcctttattccatatattatggcaggagacccaaatcttgaggaaactgcaaagagacta
aaaatacttgaacaggcaggagcagacctaatagagcttggcgttcccttttcagatcct
cttgctgatggaccgacaatacaaaaagcagcagaaagagcattaaactctggaacaacc
ttacgtaagatattgaattttcttgaggattttaaaaaaagtattaatacacccataatt
cttatgacttatttaaatcctgttttctgttacggaattgaaagattttttcatgatgca
aagggagtaaatgttggtggagttatttttcctgatctaacagttgaagagtctaagtat
tacagaacatttgcgaagaaatacggtattgatacaatatttcttgtagcaccaacatca
actcctgagagagtaaagaaaattgtaaaagcctcaacaggttttgtttactatgtttca
ataacaggaataacaggcactacacttagccttgataaatctttcaatgaccatataaat
tttgtaaaaagttttggaaaacctgtttgtgtaggctttggagtcagtaaaccagaagaa
gcaaaatatatttctcgaattgctgatggagtaattgtgggaagtgcaattgtaaaaatt
tttcatgaaaaacctgaaaaggcttctgaattcattaaatctctcagagaggcaatataa

DBGET integrated database retrieval system