KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0561Help
Entry
THEYE_A0561       CDS       T00775                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THEYE_A0561 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THEYE_A0561 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THEYE_A0561 (trpB)
Enzymes [BR:tye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THEYE_A0561 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(548581..549780)
Genome map
AA seq 399 aa AA seqDB search
MSIKKGYFGLYGGRFVPETLMPALEELDKVFNIARKDKNFINEFESLLKDYVGRPTPLYF
AKRLSEHLGGAKIYLKREDLAHTGAHKINNALGQALLASKLMKKDRIIAETGAGQHGVAT
ATGAALVGLSCDIYMGTEDIRRQSLNVFRMNLLGARVIPVDTGSRTLKDAINEALRDWTT
NVRTTHYVLGTVFGPHPYPLLVRFFQSVIGKEAKKQLLNKEGRLPDVLIACVGGGSNSIG
LFSAFLHDKDVKMIGVEAGGKGIETGLHAARFAGGAKGIFQGCLSYVLENEDGNILQTHS
VSAGLDYASVGPEHAYLKDTGRVKYTYANDEEALEAFELLSRLEGIIPALESAHAVAEAI
KIAPKMSKDSIIIVNLSGRGDKDVQEVARIKGGDGKTKI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaaaaagggatattttggtctatacgggggccgttttgttcctgaaacttta
atgcccgctcttgaagaacttgacaaggttttcaacatagccagaaaagataaaaatttt
attaacgaatttgaatctcttcttaaagactatgttggtcgccctacccctctttatttt
gcaaaaaggctaagtgaacacctgggtggtgcaaaaatttatctaaaaagagaagacctt
gcccatacaggtgcacataaaataaataacgctcttggacaagctctacttgcaagcaaa
ctcatgaaaaaggatagaattatcgctgaaacaggagcaggtcagcatggagttgcaact
gctacaggtgctgcacttgtaggacttagttgtgacatatacatgggaacagaggatatt
cgcagacagtcacttaatgttttcagaatgaaccttcttggtgcaagggttatccctgtt
gatacaggctcaaggacacttaaagatgctataaatgaagcattaagagactggacaacc
aatgtaagaacaacacattatgttttgggaactgtttttggtcctcatccatatccatta
cttgtcagattttttcagagtgttataggaaaagaggcaaaaaaacagctattaaataaa
gaaggcaggcttccagatgttcttattgcctgtgttggtggtggaagtaactcaattgga
cttttcagtgcttttttacatgataaagatgtaaagatgattggtgttgaagcaggtgga
aagggtatagaaacagggcttcatgcagccagatttgcaggaggagcaaagggaattttt
caaggatgtcttagctatgttttggaaaatgaagatggtaatatccttcaaacacattct
gtctctgctgggcttgattatgcctctgttggtcctgaacatgcctatctgaaagataca
ggaagagtaaaatacacctatgctaatgatgaggaggctttagaagcctttgaactttta
agcagacttgaaggaattattccagctcttgagtcagcccatgctgtagctgaagcaata
aagatagcaccaaaaatgtcaaaggattcaataataattgtaaacctctcaggtagaggt
gacaaggatgtgcaagaggtggcgagaatcaaaggaggagatggaaaaacaaaaatatga

DBGET integrated database retrieval system