KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0673Help
Entry
THEYE_A0673       CDS       T00775                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00790  Folate biosynthesis
tye01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THEYE_A0673 (folE)
Enzymes [BR:tye01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     THEYE_A0673 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 6942933
NCBI-ProteinID: YP_002248515
UniProt: B5YJV0
Position
667827..668393
Genome map
AA seq 188 aa AA seqDB search
MFDRKKIEEGVRLILEGIGEDVERPGIKDTPIRIARMFEEIFRGLLPPDEDLLKSIEGET
HDEMVLIKDIPFYSVCEHHLLPFFGNAHIAYIPDGRIVGLSELPKALDYLSKRPQVQERL
TSQLANLLMEKLKPKGCMVVIEAEHLCMSMRGIKKPDAKTITSAVRGIFRKSQTTRQEAL
ELINRRDK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgacagaaaaaagattgaggaaggagtaagattaattttagagggtataggagag
gatgttgaaagacctggaattaaagatacgcctattcgtattgccagaatgtttgaagag
atttttagaggattactcccaccagacgaggatttactaaaaagcattgaaggagaaacc
catgatgaaatggttttaataaaagatattcccttttattctgtttgtgaacatcatctt
ttgccattcttcgggaatgctcatattgcctatattcctgacggaagaattgtggggcta
agtgagcttcctaaggctcttgattatctttccaaaagacctcaggttcaggaaagattg
acaagccaattggctaatttgttaatggaaaagttaaagcctaagggatgtatggttgtt
attgaagcagaacacctgtgtatgagtatgagaggcataaaaaaaccggacgctaaaaca
attacttcagctgttagaggcatattcagaaaaagtcagacaacaagacaggaagcactg
gaactaattaatagaagggataaataa

DBGET integrated database retrieval system