KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0673Help
Entry
THEYE_A0673       CDS       T00775                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tye00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667827..668393
Genome map
AA seq 188 aa AA seqDB search
MFDRKKIEEGVRLILEGIGEDVERPGIKDTPIRIARMFEEIFRGLLPPDEDLLKSIEGET
HDEMVLIKDIPFYSVCEHHLLPFFGNAHIAYIPDGRIVGLSELPKALDYLSKRPQVQERL
TSQLANLLMEKLKPKGCMVVIEAEHLCMSMRGIKKPDAKTITSAVRGIFRKSQTTRQEAL
ELINRRDK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgacagaaaaaagattgaggaaggagtaagattaattttagagggtataggagag
gatgttgaaagacctggaattaaagatacgcctattcgtattgccagaatgtttgaagag
atttttagaggattactcccaccagacgaggatttactaaaaagcattgaaggagaaacc
catgatgaaatggttttaataaaagatattcccttttattctgtttgtgaacatcatctt
ttgccattcttcgggaatgctcatattgcctatattcctgacggaagaattgtggggcta
agtgagcttcctaaggctcttgattatctttccaaaagacctcaggttcaggaaagattg
acaagccaattggctaatttgttaatggaaaagttaaagcctaagggatgtatggttgtt
attgaagcagaacacctgtgtatgagtatgagaggcataaaaaaaccggacgctaaaaca
attacttcagctgttagaggcatattcagaaaaagtcagacaacaagacaggaagcactg
gaactaattaatagaagggataaataa

DBGET integrated database retrieval system