KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0694Help
Entry
THEYE_A0694       CDS       T00775                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    THEYE_A0694
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0694
  Lipid metabolism
   00071 Fatty acid degradation
    THEYE_A0694
  Amino acid metabolism
   00350 Tyrosine metabolism
    THEYE_A0694
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    THEYE_A0694
   00626 Naphthalene degradation
    THEYE_A0694
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     THEYE_A0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(685357..686373)
Genome map
AA seq 338 aa AA seqDB search
MKAWVIAKINEPLRLLEMDIPFPDYKEILIKIHACGVCHTELDEIEGRAMPAFFPVIPGH
QIVGEVVKVGSAVKKFKVGDRAGVGWIYSACGKCEYCLKGLENLCKDFKATGKDAHGGYA
EYFKIHEDFAFPIPENFANEEAAPLFCAGAIGYRSLMLAKVENKQNIGLIGFGASGHLVL
KMIKYLYPDSKVFVFSRTLSERQLSMKLGAYWTGDFDETPPEKLNSAIDTTPVWKPPIKV
LKHLKPAGRLVINAIRKEEIDKNEFLNIDYQKDLWLEKEIKSVANVTRKDIEEFLKIASQ
IPIKPEIEIYSFEDANKALKDIKERKIKGAKVLKIGGE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatgggtcattgccaaaataaatgagccattgagacttttggaaatggatatt
cctttcccagattataaagaaatattaatcaaaattcatgcttgcggagtctgtcataca
gagttggacgaaatagaaggtagagcaatgccggcattttttcctgttattccagggcat
cagattgtaggagaggttgtaaaagtcggaagtgctgtaaagaaatttaaagttggagat
agagcaggtgtaggctggatttattcagcctgtggtaaatgtgagtattgtttaaaaggg
ctggaaaatctttgcaaagactttaaagcaacaggtaaagatgctcacggtggatatgca
gagtatttcaaaattcatgaagattttgctttccctattccagaaaattttgcaaatgaa
gaggcggctcctcttttctgtgcaggagcaattgggtataggtctttgatgcttgcaaaa
gttgaaaataaacaaaacattggacttattggttttggcgcatcagggcatcttgtctta
aaaatgataaaatatttgtatccagattcaaaagtttttgtattttcaagaacattgtca
gaaagacagctttctatgaaactcggtgcatactggacaggggattttgatgaaacacca
ccagaaaaattaaattcagcaattgatactactcccgtgtggaaaccgcctattaaagtt
cttaaacatcttaaacctgctggaaggcttgtaataaatgcgataaggaaagaagaaatt
gataaaaatgaattcttaaatattgattatcagaaagatttatggcttgaaaaagaaatc
aaatcagtggctaatgttacaagaaaagatattgaagaatttcttaaaattgcctcacaa
ataccaataaagcctgagattgaaatatattcttttgaagatgctaataaagcactcaaa
gatataaaagaaagaaaaataaaaggcgcaaaagttttaaaaattggaggagaataa

DBGET integrated database retrieval system