KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0719Help
Entry
THEYE_A0719       CDS       T00775                                 

Gene name
hemG
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00860  Porphyrin and chlorophyll metabolism
tye01100  Metabolic pathways
tye01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THEYE_A0719 (hemG)
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     THEYE_A0719 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     THEYE_A0719 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 Thi4 MCRA Lycopene_cycl Pyr_redox Pyr_redox_3 HI0933_like FAD_binding_2 Trp_halogenase Mqo FAD_binding_3 T6SS_VasE
Motif
Other DBs
NCBI-GeneID: 6942648
NCBI-ProteinID: YP_002248561
UniProt: B5YJZ6
Position
710963..712315
Genome map
AA seq 450 aa AA seqDB search
MGSAEIVIVGGGISGLSLAYFLIQKNSQLNIKIVEAEKRAGGKIITENISGFLCEGGVNG
FLSNKPSTISLAKELNIEPLRGSESSKIRYILIDGKLIRVPENPIKFFLTPLLSFSGKIR
MLREYFTPPLKEEIDETVESFVSRRVGKEFYEKLIDAMSTGIYAGDPSKMSMKSCFPKVY
WLEKRHGGLLKGLIALKKEKKDTKAQPSGVLMSFKGGMSELIQSLERHLSSRILKGKKVL
SIDRKNTYYTVHLDDGNFIEAEKVILACPAHESAEILKELSSELSDILKTIPYPPLSVVA
FGFKKEQIGFGTSLYGFLIPYREQRKILGTLFDSSIFPNRAPESYVLLRSMIGGRRAPEL
AMLPDEKLIDTALSELKPLLNIKGDPEFIKIFRWEKAIPQYELGHEDKLNRIEQILSEFS
GLYLTGNAYRGVSVNDCIENSLKLAEGIMV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggttcagcagaaatagttattgttggcggcgggatttccggtctttctcttgcctat
tttttaatacagaaaaattctcagcttaatataaagatagttgaagcagaaaaaagagca
ggcggtaaaattattacagaaaatatatcaggattcctctgtgaaggtggtgtaaatggt
tttttaagtaataaaccatcaacaatatcacttgcaaaggaattaaatatagagccttta
agaggtagcgagagctcaaaaataagatatattctcattgatggaaaacttataagagtt
ccagagaatcccattaaattttttcttactcctctgctttctttttcaggcaaaataaga
atgcttagagaatattttactccaccattaaaagaagaaattgatgagactgtggaaagt
tttgtatcacgaagagtaggtaaagagttttatgaaaaacttattgatgccatgtcaaca
ggaatttatgcaggagacccttcaaagatgagcatgaaaagctgttttccaaaagtatat
tggcttgaaaagagacatggaggactccttaaaggattgattgctttaaaaaaagaaaag
aaagatacaaaagctcagccatctggtgtgctcatgtcttttaaaggaggaatgtcagag
cttatacaaagccttgaaagacatctttcatcaagaattttaaaaggtaaaaaggtttta
agcatagacagaaaaaacacttactacacagtgcatcttgacgatggtaattttattgag
gctgagaaagttattcttgcctgtcctgcccatgaatctgcagaaatacttaaagaatta
agcagtgagctttcagatattttaaagacaattccctatccacctctgagtgttgtagcc
tttggatttaaaaaggagcagattggttttggaacatccctttatggttttttaatccct
tacagagagcaaagaaagattcttggaacactttttgactcaagcatatttcccaataga
gcacctgaaagctatgttttacttagaagtatgattggaggaagaagagcccctgagctt
gcaatgttgcctgatgaaaaacttattgatacagctttatcagagttgaagcctctttta
aatatcaaaggagacccagagtttataaaaatattccgatgggaaaaagcaatacctcag
tatgagttagggcatgaggacaaacttaatcggattgagcagattctttcagagttttct
gggctttatcttacaggtaatgcctacagaggtgtgagtgtaaatgactgcattgaaaac
tcattgaagctggctgaagggattatggtttaa

DBGET integrated database retrieval system