KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0773Help
Entry
THEYE_A0773       CDS       T00775                                 

Definition
(RefSeq) succinate dehydrogenase membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00020  Citrate cycle (TCA cycle)
tye00190  Oxidative phosphorylation
tye00650  Butanoate metabolism
tye01100  Metabolic pathways
tye01110  Biosynthesis of secondary metabolites
tye01120  Microbial metabolism in diverse environments
tye01130  Biosynthesis of antibiotics
tye01200  Carbon metabolism
Module
tye_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THEYE_A0773
   00650 Butanoate metabolism
    THEYE_A0773
  Energy metabolism
   00190 Oxidative phosphorylation
    THEYE_A0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C E1-E2_ATPase
Motif
Other DBs
NCBI-GeneID: 6941325
NCBI-ProteinID: YP_002248615
UniProt: B5YK50
Position
762247..762561
Genome map
AA seq 104 aa AA seqDB search
MWSWLLHRITGVILVVGLLYHFILMHFMGHDNYSYNAVMQRLSEPSWKIFNIVFLFSALY
HGFYGLNGVVTEYVRNNSLKRILKFMAFTVPIGLAFYGFKIVFF
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtggagttggcttttgcatagaataacaggtgtgattcttgtagttggattgctatat
catttcattctaatgcacttcatggggcatgataactattcttataatgcggttatgcag
agacttagtgagccttcatggaaaatttttaatattgtttttctcttttcagccttatat
cacggattttatggactcaatggagttgtaacagagtatgtgagaaataattcattgaaa
agaatattgaaatttatggcatttactgttccgataggtcttgcattttatggatttaaa
atagtttttttctaa

DBGET integrated database retrieval system