KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0773Help
Entry
THEYE_A0773       CDS       T00775                                 

Definition
succinate dehydrogenase membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THEYE_A0773
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THEYE_A0773
   00650 Butanoate metabolism
    THEYE_A0773
  Energy metabolism
   00190 Oxidative phosphorylation
    THEYE_A0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762247..762561
Genome map
AA seq 104 aa AA seqDB search
MWSWLLHRITGVILVVGLLYHFILMHFMGHDNYSYNAVMQRLSEPSWKIFNIVFLFSALY
HGFYGLNGVVTEYVRNNSLKRILKFMAFTVPIGLAFYGFKIVFF
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgtggagttggcttttgcatagaataacaggtgtgattcttgtagttggattgctatat
catttcattctaatgcacttcatggggcatgataactattcttataatgcggttatgcag
agacttagtgagccttcatggaaaatttttaatattgtttttctcttttcagccttatat
cacggattttatggactcaatggagttgtaacagagtatgtgagaaataattcattgaaa
agaatattgaaatttatggcatttactgttccgataggtcttgcattttatggatttaaa
atagtttttttctaa

DBGET integrated database retrieval system