KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0877Help
Entry
THEYE_A0877       CDS       T00775                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tye03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(846339..846911)
Genome map
AA seq 190 aa AA seqDB search
MLDFIKGKVITVKPDKIVIQTGGIGYSVKIPIRVSRYINRDEETQIFTSLIVKEESIEIY
GFLESSERDLFEELIKIAGIGPKMAINILSTYDRETLYKIIDHEDIKSLSKIPGIGKKTA
QRILLELRGILPSLQYEKDQKYDDILSALLNLGYKRLEAKEVLDKIYNNEKDEATIIRES
LSILAGKDGK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatttcataaaagggaaagttattacagttaaaccggataagattgttattcaa
acaggtgggatcggttattcagttaaaataccaatcagagtgtccagatatattaacaga
gatgaagaaactcagatttttacatctctaattgtaaaagaagaatccattgaaatttat
ggatttttagaaagctcagagagagacctttttgaggaactaataaaaattgcaggcatt
ggtccaaaaatggcaatcaatattctttcaacctatgatagagaaactctttacaaaata
attgaccacgaagatataaaatcactaagcaaaattcctggaattggtaaaaaaactgct
caaagaattcttcttgaattgagaggtattttgccttctttgcaatatgaaaaagaccag
aaatatgatgatattttgtcagctcttttaaatcttgggtataaaagacttgaagcaaaa
gaagttttggataaaatttataataatgaaaaagatgaagcaacaataattagggagtct
ttgagtatattagctggaaaagatggaaaataa

DBGET integrated database retrieval system