KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0897Help
Entry
THEYE_A0897       CDS       T00775                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Brite
Enzymes [BR:tye01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     THEYE_A0897
Secretion system [BR:tye02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   THEYE_A0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
868159..868890
Genome map
AA seq 243 aa AA seqDB search
MKRTSFLGIFLIISLLSCNLTTNPCTNIKEKELKETLKIDFDSIVEKNEIKGTNLCQIVI
QRNGVFNIFYAYPDGKTFIFGDIYKNGIFLSKATLERIQEKAFKNFQTEIDKVVVFSYKP
EGANKYIYMITDPDCPFCEKAKQEVKQWADLKKVEIKVIFLPLETLHPHAKDKAIRAVCA
GMKYDDYLNSKWVGQLCNDGTKKIQDSIALMKKINVNGTPSFISFNGKRIVGFSPEGLDA
IIN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggacaagctttttagggatatttttaattatcagtttgttatcttgtaattta
actaccaatccatgcacaaatataaaggaaaaggaactaaaagaaactttaaaaattgat
tttgatagcatagttgaaaaaaatgaaattaaaggaacgaatctctgtcagattgtaatt
caaagaaatggtgtattcaatattttttatgcatatcccgatggaaagacttttatattc
ggagatatctataaaaatggtatatttttaagcaaagcaacattggaaagaatacaggaa
aaggctttcaagaattttcaaacagagattgataaagtagttgttttttcttataaacca
gaaggtgctaataagtatatctatatgattactgatccagattgtccattctgtgaaaag
gcaaaacaagaagtgaaacagtgggcggatttaaaaaaggttgagataaaggttatattt
ttacctcttgaaactcttcatcctcatgcaaaagacaaggctataagagcagtctgcgca
ggaatgaaatatgatgactacttgaattcaaaatgggtagggcagctatgcaatgatgga
actaaaaaaatacaagattcaattgctttgatgaaaaagattaatgtaaatggaacgcct
tcttttatttcttttaatggtaagcgaatagtggggttttcacctgaaggacttgatgct
atcataaactaa

DBGET integrated database retrieval system