KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0908Help
Entry
THEYE_A0908       CDS       T00775                                 

Definition
(RefSeq) pyruvate synthase subunit PorD
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00010  Glycolysis / Gluconeogenesis
tye00020  Citrate cycle (TCA cycle)
tye00620  Pyruvate metabolism
tye00633  Nitrotoluene degradation
tye00640  Propanoate metabolism
tye00650  Butanoate metabolism
tye00680  Methane metabolism
tye01100  Metabolic pathways
tye01120  Microbial metabolism in diverse environments
tye01130  Biosynthesis of antibiotics
tye01200  Carbon metabolism
Module
tye_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0908
   00020 Citrate cycle (TCA cycle)
    THEYE_A0908
   00620 Pyruvate metabolism
    THEYE_A0908
   00640 Propanoate metabolism
    THEYE_A0908
   00650 Butanoate metabolism
    THEYE_A0908
  Energy metabolism
   00680 Methane metabolism
    THEYE_A0908
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THEYE_A0908
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THEYE_A0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_2 Fer4_15 Fer4_10 Fer4_16 Fer4_13 Fer4_4 Fer4_17 Fer4_8 Fer4_22
Motif
Other DBs
NCBI-GeneID: 6942235
NCBI-ProteinID: YP_002248744
UniProt: B5YKH9
Position
876065..876352
Genome map
AA seq 95 aa AA seqDB search
MIGWKKIPPGMVILEPGSALKFKTGSWRAFKPRWIEENCIQCLLCWLYCPDNAVKVKDGK
REDFDFDYCKGCGICALECPGKKGNKAIVMEEEVK
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgataggatggaaaaaaataccaccaggaatggtaatacttgagccagggagtgctcta
aaatttaaaacaggttcatggagagcttttaagccaagatggatagaggaaaattgtatt
caatgtcttctttgctggctttattgccctgataatgcagtaaaggttaaagatggaaag
agagaggattttgattttgattattgcaaaggatgtggaatctgcgctcttgagtgtcct
ggtaaaaaaggtaataaggcaattgtaatggaagaggaggtgaaataa

DBGET integrated database retrieval system