KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0909Help
Entry
THEYE_A0909       CDS       T00775                                 

Definition
(RefSeq) pyruvate synthase subunit PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
tye00010  Glycolysis / Gluconeogenesis
tye00020  Citrate cycle (TCA cycle)
tye00620  Pyruvate metabolism
tye00633  Nitrotoluene degradation
tye00640  Propanoate metabolism
tye00650  Butanoate metabolism
tye00680  Methane metabolism
tye01100  Metabolic pathways
tye01120  Microbial metabolism in diverse environments
tye01130  Biosynthesis of antibiotics
tye01200  Carbon metabolism
Module
tye_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0909
   00020 Citrate cycle (TCA cycle)
    THEYE_A0909
   00620 Pyruvate metabolism
    THEYE_A0909
   00640 Propanoate metabolism
    THEYE_A0909
   00650 Butanoate metabolism
    THEYE_A0909
  Energy metabolism
   00680 Methane metabolism
    THEYE_A0909
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THEYE_A0909
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THEYE_A0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_N
Motif
Other DBs
NCBI-GeneID: 6942673
NCBI-ProteinID: YP_002248745
UniProt: B5YKI0
Position
876352..877533
Genome map
AA seq 393 aa AA seqDB search
MTKVVAVTGNEAVANAFRQIEPDVCAAYPITPQTELMQRFAAFVSDGKVKTELILVESEH
SALSACVGAAAAGGRVATATSSQGLALMWEILFIASGLRLPIVMPVVNRALSAPINIHCD
HSDAMGARDSGWIQLWSENAQEAYDNTIQAFRIAEDMDIRLPVMVCYDGFIISHSIERIE
YLDDETVKKFVGEYKPLYPLLDIDNPKSYGPLILTDLYHEVRKAHSEVYKNVPKVVLKVA
KEFEKISGRKYGLFETYRLDDAEIGIVILNSAAGTTKDVIDEYRDRGIKVGLLKPRLFRP
FPYEEVGKALKHLKAVCVLDRADAFGGSFGPLYLDIAASLCNYSEKPLLINRIYGLGGRD
YMPEHASEVIEELKKIAKTGKIKILKEYIGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtggttgcagttacaggaaatgaagcagttgcgaatgcctttcgtcagata
gaacctgatgtatgcgcagcctatccaataacaccgcagactgagcttatgcagagattt
gctgcatttgtatctgatggaaaagtgaaaacagagcttattcttgttgaaagtgaacat
tctgccctgagtgcatgcgttggagctgctgcagcaggtggaagagttgcaacagctaca
tcttctcaaggattggcgctcatgtgggagattctttttattgcctctgggttaaggctt
ccaattgttatgcctgttgtaaatagggcactttctgcaccgataaatattcactgcgat
cattctgatgcaatgggagcaagagatagtggatggattcagctttggagtgaaaatgcc
caagaagcctatgataacacaattcaggcattcagaattgctgaagatatggatataaga
cttccagtaatggtttgttatgacggttttataataagccattcaatagaaagaattgaa
tatcttgatgatgaaactgttaaaaaatttgttggagaatataaacctctttatcctctc
ttagatattgataatccaaaaagctatggaccgcttattcttactgatttatatcatgag
gtaagaaaagctcattcagaggtttataaaaatgttccaaaagttgtacttaaagttgca
aaggagtttgaaaagatatcaggtagaaaatatggactttttgaaacatacaggcttgat
gatgcggagataggaattgttattttaaattccgcagcaggaaccaccaaagatgtaata
gatgaatacagagatagaggtataaaggttggacttcttaaaccaagactttttagaccc
ttcccatatgaagaagtaggtaaagcccttaaacatttaaaagcagtatgtgttcttgac
agagcagatgctttcggtggttcttttggacctctttatcttgatattgcagccagttta
tgtaattattctgaaaagcccttacttataaacagaatatacggtcttggtggaagagac
tatatgccagagcatgcttcagaggtaattgaagagttaaagaagattgcaaaaacagga
aaaataaaaattttaaaagaatacattggagtgagggagtaa

DBGET integrated database retrieval system