KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0909Help
Entry
THEYE_A0909       CDS       T00775                                 

Definition
(RefSeq) pyruvate synthase subunit PorA (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THEYE_A0909
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0909
   00020 Citrate cycle (TCA cycle)
    THEYE_A0909
   00620 Pyruvate metabolism
    THEYE_A0909
   00640 Propanoate metabolism
    THEYE_A0909
   00650 Butanoate metabolism
    THEYE_A0909
  Energy metabolism
   00680 Methane metabolism
    THEYE_A0909
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THEYE_A0909
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THEYE_A0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
876352..877533
Genome map
AA seq 393 aa AA seqDB search
MTKVVAVTGNEAVANAFRQIEPDVCAAYPITPQTELMQRFAAFVSDGKVKTELILVESEH
SALSACVGAAAAGGRVATATSSQGLALMWEILFIASGLRLPIVMPVVNRALSAPINIHCD
HSDAMGARDSGWIQLWSENAQEAYDNTIQAFRIAEDMDIRLPVMVCYDGFIISHSIERIE
YLDDETVKKFVGEYKPLYPLLDIDNPKSYGPLILTDLYHEVRKAHSEVYKNVPKVVLKVA
KEFEKISGRKYGLFETYRLDDAEIGIVILNSAAGTTKDVIDEYRDRGIKVGLLKPRLFRP
FPYEEVGKALKHLKAVCVLDRADAFGGSFGPLYLDIAASLCNYSEKPLLINRIYGLGGRD
YMPEHASEVIEELKKIAKTGKIKILKEYIGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtggttgcagttacaggaaatgaagcagttgcgaatgcctttcgtcagata
gaacctgatgtatgcgcagcctatccaataacaccgcagactgagcttatgcagagattt
gctgcatttgtatctgatggaaaagtgaaaacagagcttattcttgttgaaagtgaacat
tctgccctgagtgcatgcgttggagctgctgcagcaggtggaagagttgcaacagctaca
tcttctcaaggattggcgctcatgtgggagattctttttattgcctctgggttaaggctt
ccaattgttatgcctgttgtaaatagggcactttctgcaccgataaatattcactgcgat
cattctgatgcaatgggagcaagagatagtggatggattcagctttggagtgaaaatgcc
caagaagcctatgataacacaattcaggcattcagaattgctgaagatatggatataaga
cttccagtaatggtttgttatgacggttttataataagccattcaatagaaagaattgaa
tatcttgatgatgaaactgttaaaaaatttgttggagaatataaacctctttatcctctc
ttagatattgataatccaaaaagctatggaccgcttattcttactgatttatatcatgag
gtaagaaaagctcattcagaggtttataaaaatgttccaaaagttgtacttaaagttgca
aaggagtttgaaaagatatcaggtagaaaatatggactttttgaaacatacaggcttgat
gatgcggagataggaattgttattttaaattccgcagcaggaaccaccaaagatgtaata
gatgaatacagagatagaggtataaaggttggacttcttaaaccaagactttttagaccc
ttcccatatgaagaagtaggtaaagcccttaaacatttaaaagcagtatgtgttcttgac
agagcagatgctttcggtggttcttttggacctctttatcttgatattgcagccagttta
tgtaattattctgaaaagcccttacttataaacagaatatacggtcttggtggaagagac
tatatgccagagcatgcttcagaggtaattgaagagttaaagaagattgcaaaaacagga
aaaataaaaattttaaaagaatacattggagtgagggagtaa

DBGET integrated database retrieval system