KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0910Help
Entry
THEYE_A0910       CDS       T00775                                 

Definition
pyruvate synthase subunit PorB (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THEYE_A0910
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THEYE_A0910
   00020 Citrate cycle (TCA cycle)
    THEYE_A0910
   00620 Pyruvate metabolism
    THEYE_A0910
   00640 Propanoate metabolism
    THEYE_A0910
   00650 Butanoate metabolism
    THEYE_A0910
  Energy metabolism
   00680 Methane metabolism
    THEYE_A0910
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    THEYE_A0910
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     THEYE_A0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
877535..878488
Genome map
AA seq 317 aa AA seqDB search
MATPLNLKELSKKELRFTSGHRLCAGCAAPTVVKMILLAACDYPVIAASATGCLEVSSCI
STYTAWKIPWIHNAFENAAATLSGVETMYRALKKQGKIDKDIKFIAISGDGGTYDIGFQS
LSGAMERGHDMLYVCYDNEAYMNTGIQRSGATPTFADTTTCPAGSVIPGKPQQRKDLTRI
MAAHGLPYVAQASPSHWPDLMKKVRKALEIPGPKFINVFTPCNRGWRTRTDDAILLSRLA
VETCFWPLYEVENGVIKITVKPKEKKPIVDFLKAQGRFKHLFEPGKEHLIDQIQQMIDRN
WERLLKEEELFAPKEAK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccacttaatttaaaggaactatctaaaaaagaattaagatttacatcaggt
catcgtctctgtgcaggatgtgcagcaccgacagttgtcaagatgattcttcttgcagcc
tgtgattatcctgttattgccgcatctgctacaggatgccttgaagtttcatcttgcata
tcaacatatactgcatggaagattccttggatacataatgcctttgaaaatgctgctgca
acactttctggtgttgagacaatgtacagagctttaaaaaagcaggggaaaattgataaa
gatattaaatttattgctatatctggtgatggtggaacttatgacataggatttcaaagc
ctttcaggtgctatggaacggggacatgacatgctttatgtatgttatgacaatgaagca
tatatgaacactggaattcaacgttctggggctactccaacttttgcagatacaacaacc
tgtccagcaggttctgttatccccggaaaacctcaacaaaggaaagatttaacaagaatt
atggcagctcatggactgccttatgtggcgcaggcatcaccaagccattggcccgattta
atgaaaaaggtgaggaaagcacttgagataccaggtcctaaatttatcaatgtatttaca
ccatgcaatagaggttggagaaccagaacagatgatgctattctgcttagccgattagca
gttgaaacctgtttctggccactctatgaagtggaaaatggagttataaaaataacagtc
aaaccaaaagaaaaaaaacctattgttgatttcttaaaagcgcagggaagatttaaacac
ctatttgaacctggtaaagaacatctcattgatcaaattcagcagatgattgatagaaac
tgggaaagacttttaaaagaagaagaactgttcgctcctaaggaagccaaatag

DBGET integrated database retrieval system