KEGG   Thermodesulfovibrio yellowstonii: THEYE_A0931Help
Entry
THEYE_A0931       CDS       T00775                                 

Definition
peptidase TldD
Orthology
K03568  
TldD protein
Organism
tye  Thermodesulfovibrio yellowstonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(898528..899883)
Genome map
AA seq 451 aa AA seqDB search
MEFFNDILNNLKGDYVDIFFEEKTTNQLQMEENKIQKCSAIIDKGLGVRLIIGEKIFYAY
TNDITKNGIAELISSLKNYKHAGSCINLKKFSSPNQFFIKRNPQDVNILEKIKFVKKAND
TSWIQNKKITQVKVFYSDMIQKIKVANSEGYFAEEERIYTLFLVHAIASENETIQTGYEA
VGGLKGIELFEEISPEEIAIKATKRAIMMLKAKRIKGGRMPVVISSEAGGTMIHEAVGHG
LEADLVQEGISVYSGKLGDKVASEFITVIDDPTLPNMRGSYIFDDEGTPSQRTILVENGV
LVNYLYDKYTSMKEGKASTGNGRRQSYEHYPIPRMSNTFIAPGNHSPEEIVRSVDKGLFV
KKMGGGQVNTVTGEFVFEVQEGYLIEKGLIGEPIRGALLIGTGQEILKNIDMVGSDLGFS
IGTCGKNAQGVPVTDGMPTIRIPEIVVGGQA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggagttttttaatgacatactaaataacttgaagggtgattatgtagatatatttttt
gaagaaaaaactacaaatcagcttcagatggaagaaaataaaattcagaaatgctctgct
attattgataaaggtttgggagttagattaattataggtgaaaaaatattttatgcatat
acaaatgatattacaaaaaatgggattgctgaattaatatcatccttgaaaaattacaaa
catgcaggaagttgtatcaatttaaaaaaattttcttctccaaatcaatttttcataaaa
aggaatccgcaggatgtcaacattttagaaaaaattaaatttgttaaaaaagcaaatgat
acatcatggatacagaacaaaaaaataacacaggtaaaagttttctactctgacatgata
caaaaaataaaagttgcaaactctgaaggatattttgctgaagaagagaggatttataca
ctattcctggtacatgccattgcatcagaaaatgaaactattcagacaggttatgaagca
gttggaggattaaaaggaatagaactttttgaagaaatatcacctgaagaaattgcaatt
aaagctactaaacgagctattatgatgttaaaagcaaagagaattaaaggtggacgcatg
cctgttgtaatatcttcagaggctggaggaacaatgatacatgaagcagtcgggcatggt
ctggaagcagaccttgttcaagagggaatttctgtatatagcggaaaacttggtgataag
gttgcctcggaatttataacagttatagatgatcctactcttcctaatatgagaggctca
tatatttttgatgatgaaggaactccatctcaaagaactattttagttgaaaatggagtt
ctggttaactatctttatgataaatatacatcaatgaaagaagggaaagcctctacagga
aatggtagaagacaatcatatgaacattatccaattccaagaatgagtaatacatttatt
gcaccagggaatcattctcctgaggaaatagtccgttcagttgataaaggactttttgtt
aaaaaaatgggcgggggtcaggtaaataccgtaacaggagaatttgtttttgaagttcag
gaaggatatttaattgaaaaagggttaattggagaacctataaggggagcattattaatt
ggcacaggacaagaaattttaaagaatattgatatggtaggaagcgacttaggattttca
atcgggacatgtggaaaaaatgctcaaggagttcctgtcactgatggcatgccaacaata
agaattcctgagattgttgttggaggacaagcataa

DBGET integrated database retrieval system