KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1074Help
Entry
THEYE_A1074       CDS       T00775                                 

Definition
magnesium-chelatase subunit ChlD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tye00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1043941..1045785)
Genome map
AA seq 614 aa AA seqDB search
MQSLKEYKINFFNFVNQENAKLALLLNLIEPKSGGVLLAGKRGTGKSTLLRAFCDMLRQL
KIPSVLLPMNSTEEAVLGGIDIEETIKTGKRVFQKGLLSRANRGFLIVEDINLFPQDILS
IVFEVQAREENIIEREGITLREPAQFQIIATMNPEEADFSSHFLDRFGMCVIMDEVRDKD
KKVEILKLNALDECHFTEQHQLFRKILKYKEFIKKVKVSDEIKEFIANLILNEAVSGHRG
DIYLYYASKAFAAYREEETVTEEHVKAVAHLVLNHRRRAIEPEPEEKKHEQEHETDSSNN
SENRQEQKDREQKTPLSQSQESHDGKSQSIPSSEKEEIFPIGEKFKVKRFIFKKDRIVRQ
TTGRRTKTKTKGRGGRYVRSLMQKRPDIAIDATLRAAAPFQKLRAMKDNVVIFDDDLRYK
EKERRMSHNVIFVVDGSGSMGVEQRMKATKGAVLSLLIDCYKKRDKVAMIVFRKDKAEIL
LPLTSSVELALKRLREIPTGGKTPLSAGLMEAYKLMKITHFKYPENRLLILIITDGKPNV
SLSDKPVLEELKSVCFMLKDFPLTDFIVIDTEKKDKFMKMDLAIEIAEWLQATYHSIDSL
KSESLLNIVKTHKG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccttgaaagaatataaaataaacttttttaacttcgtaaatcaggaaaatgcc
aaacttgctctcttacttaatttaattgagccaaaatctggcggtgttttactggctgga
aaaagaggcacaggaaaatcaactcttcttagagcattttgcgatatgttgagacagctg
aaaattccctctgttctacttccaatgaattctactgaagaggcggttttgggtggaatt
gatattgaagaaactataaaaactgggaaaagagtttttcagaaaggacttctttcaagg
gcaaacagaggttttcttatcgttgaagatattaatctttttccacaggatattctctca
attgtttttgaagttcaggcaagagaagaaaatatcattgaaagagaaggaattactttg
agagagcctgctcagtttcagattattgcaaccatgaatcctgaagaggctgatttttca
tctcactttcttgacagattcggcatgtgcgtgattatggatgaagtaagggataaagat
aaaaaagtcgaaatattgaagttaaatgctttagatgaatgccattttacagagcaacat
caattatttagaaaaatattaaaatacaaagagtttataaaaaaagttaaagtttcagat
gagataaaagaatttattgcaaatttgattttaaatgaagctgtttctgggcatagagga
gatatttatctttactatgcctctaaagcctttgctgcatacagggaagaggagactgtt
actgaggagcatgttaaagcagtggcacaccttgttttaaatcatagaagaagagctatt
gaaccagagcctgaagaaaagaaacacgaacaagaacatgaaaccgacagttcaaataat
tcagaaaacagacaagagcaaaaagacagagaacaaaaaactcctctttcccaaagccaa
gaatcccatgatggtaaatctcagagtattccttcttctgaaaaagaggaaattttccca
attggtgaaaaatttaaagtaaagagatttattttcaagaaagatagaatagtaaggcaa
acaacaggaagaagaacaaagactaaaacaaagggtaggggaggtagatatgtaagaagt
cttatgcaaaaaagaccagatattgcaattgatgcaactctgagagccgcagcacctttt
caaaaactcagagcaatgaaggataatgtagtaatttttgatgatgaccttagatacaaa
gaaaaagagagaagaatgagccataatgtaatttttgttgttgatggttcaggttctatg
ggtgtagagcagagaatgaaggcaacaaaaggagcagtgctttcgttgcttatagattgc
tataaaaagcgtgataaagtggctatgattgttttcagaaaagataaagctgagatatta
cttccgcttacatcttcagtggaactcgcgttaaaacgtctgagagagattccgactgga
ggtaaaactcctctttcagctggacttatggaggcttataaattaatgaaaataacacat
tttaagtatcctgaaaatagattattaattttgattattacagatggaaaaccaaatgta
tccttgagtgataaacctgttttggaagaacttaaaagtgtttgttttatgttaaaagat
tttccgttaacagatttcattgttattgatacagaaaaaaaggacaaatttatgaaaatg
gatttagcaattgagattgcagaatggcttcaagcaacatatcattcaatagattcactc
aaaagtgaaagtcttttaaacattgttaaaactcataaaggttag

DBGET integrated database retrieval system