KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1075Help
Entry
THEYE_A1075       CDS       T00775                                 

Definition
magnesium-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THEYE_A1075
Enzymes [BR:tye01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     THEYE_A1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1045763..1046773)
Genome map
AA seq 336 aa AA seqDB search
MIFPFTAIVDQEEMKLALILNVIDPSIGGVLIMGEKGTAKSTTVRALADLLPEIDAVKGC
RFCCSPQGPFCSDCLDKIEKNQALENEKKKMRVVELPLGVTEDRVVGSLDIEHAIKRGEK
RFEPGILADANRNFLYVDEVNLLEDHIVDLLLDSAAMGINTVEREGVSFVHPARFILVGT
MNPEEGELRPQLLDRFGLCVQVNSIRDKALRVEILKRKAEFDDDHEGFHKKWQNAQAELA
EKIINAKERLKDVTINEESVSAVVDITAELNLDGHRADIVMLKAARAFAAFSGRAEITQE
DIKKIAPLALRHRLKRLPFEDISQEAEKLHAILERI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatttttccctttactgctattgttgaccaggaggagatgaagcttgctcttattttg
aatgttattgacccaagtattggtggtgttttaataatgggagagaaaggcacagctaaa
tcaacaacagtgcgtgctttggctgatttacttcctgaaattgatgctgttaaaggatgt
agattctgttgctcacctcagggacctttttgtagtgattgtttggataagattgaaaaa
aatcaagccttagagaatgaaaagaaaaaaatgcgggttgtggagcttcctttgggtgtt
acagaagacagagttgtaggcagccttgatattgaacatgccataaaaagaggtgagaaa
cgctttgagccaggaattcttgctgatgcaaacagaaattttctctatgttgatgaggta
aatttgcttgaagaccatattgttgaccttttgcttgactctgctgctatgggaattaat
acagttgaaagagaaggtgtttcctttgttcatcctgcaagatttattcttgtaggcact
atgaatcctgaggaaggagagctgagacctcagcttcttgacagatttggtctctgtgtt
caggttaattcaataagggataaagcactaagggttgaaattttaaaaagaaaagcagag
tttgatgatgaccacgagggattccataaaaagtggcagaatgctcaggcagagcttgca
gaaaagataatcaatgcaaaagaaagacttaaagatgtaactatcaatgaagaatcagtc
tcagctgttgtggatatcaccgcggagctaaaccttgatggtcacagggcagacatagtc
atgcttaaggctgcaagagcttttgctgcattcagtggaagagctgaaataacccaggaa
gatataaaaaagattgctccgcttgctctgagacacagacttaaaaggcttccctttgag
gatatctcgcaagaggcagagaaacttcatgcaatccttgaaagaatataa

DBGET integrated database retrieval system