KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1144Help
Entry
THEYE_A1144       CDS       T00775                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tye01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tye01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tye00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tye00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tye00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1122803..1123543
Genome map
AA seq 246 aa AA seqDB search
MPKKFIVANWKMHKTVREALAFLDEFIPITKGLNGREIGIAPTFICIESVGKVLINTSIK
LCAQNAFYENKGAYTGEVSPAMLKDCGVEYVIIGHSERRKYFYENDDIINKKIHACIKEG
LKVIFCIGETFEDRQNNKTMEILKTQIRNGLLEINSPEALTIAYEPVWAIGTGVVATEEQ
IKQSHLFIRNQLKEIYGERANEVRILYGGSVTPENIKSIMAIDNVEGVLVGGASLDPLKF
AKIVKY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagaaatttattgttgccaactggaagatgcataaaacagtgagagaagctctt
gcatttctggacgaatttattccaattactaaggggttaaacggcagagagataggtatc
gcaccaacttttatttgtattgaaagcgttggcaaagttttgataaataccagcataaaa
ctctgtgcacaaaatgctttctatgaaaacaaaggagcctacacaggtgaagtatctccg
gcaatgctaaaggattgtggtgttgaatatgtaataatcggacattcggaaagaagaaag
tatttttatgaaaatgatgacattattaataaaaagattcatgcttgtattaaagaagga
ttgaaagtgattttctgtattggtgaaacctttgaagatagacagaacaataaaacaatg
gaaattttaaaaactcaaatcagaaatggactgttggaaataaattctccagaagccctt
acaattgcctatgagcctgtatgggcaattggaacaggcgttgtagccactgaagagcaa
ataaaacaatcacacttgttcataaggaatcagcttaaggaaatctatggtgaaagagct
aatgaggttaggattctttacggggggagtgtgactccagaaaacatcaagtctattatg
gcaattgataatgttgaaggagttctggttggtggtgcaagtttagatcctttaaagttt
gcaaaaattgtaaagtattaa

DBGET integrated database retrieval system