KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1303Help
Entry
THEYE_A1303       CDS       T00775                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tye  Thermodesulfovibrio yellowstonii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1262413..1263492)
Genome map
AA seq 359 aa AA seqDB search
MLRRNSILIFLCLIALFFNIEGFASEKKKKKIQPLPAVPVPENNPMTQEKIELGKKLFFD
RRLSGDGTTSCASCHDPEKAFTDASEISLSYPTTRNFRNAPTLMNSAYAKHLFWDGRAKT
LEEQAEFPIMSPFEMNQNLDFVEEEIRIVPEYREAFKRIFGQDVNIKLIAKAIAAFERTL
ISKNAPIDRYLKGDKNALSSEAKKGLEIFTGKGKCIDCHYGYYLSDQEFHALMVPENPKY
ANEDKFIVTRRYVAKINKYPDYMNIKEDLGRYFKTKKQKDYKAFKTPTLREVAKTAPYMH
NGIFKSLDEVIDFFNKGGGEGNKVLKPLNLTEEEKKVLKTFLVEALSGEDLKIKPPDIP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaagaaatagtattttaatttttttatgcttgattgccttgttttttaatatt
gaaggctttgcttctgaaaaaaagaaaaagaaaattcagcctttgccagcggtgcctgtt
cctgagaataacccaatgactcaggaaaaaatagaacttggtaaaaagctgttttttgac
agaagactttcaggcgatggaacaacaagttgtgcaagctgtcatgaccctgagaaggca
tttacagatgcctctgagatatctctaagttatcccaccacaagaaactttaggaatgct
ccgactcttatgaattctgcttatgctaaacatcttttctgggatggacgagctaaaaca
ttagaagaacaggcagagtttcccattatgtcaccttttgaaatgaatcaaaatcttgat
tttgtagaggaagaaattagaatagtgcctgaatacagggaagcatttaagaggattttt
gggcaggatgtaaatattaaattgattgcaaaggctattgctgcttttgaaagaactcta
atttcaaaaaatgcacctattgacagatacctcaaaggagataaaaacgcattatcttct
gaagctaaaaaaggacttgaaatatttacaggtaaaggaaaatgcatagattgtcattat
ggttattacttaagtgatcaggaatttcatgcgcttatggttcctgaaaatccaaaatat
gctaatgaagacaaatttattgttacaagaagatatgtagcaaagataaataaatatcca
gactacatgaatatcaaggaagacctcgggagatatttcaaaaccaaaaaacaaaaagat
tataaagcgtttaaaacacctacattgagagaggttgcaaaaactgctccatatatgcat
aatggtatattcaagagtcttgatgaagttatagacttttttaataagggtggaggagaa
ggtaataaagttttgaaacctcttaacttgactgaagaagagaaaaaagttttaaaaaca
tttcttgttgaagccctgagtggcgaagatttaaaaataaaaccacctgatattccataa

DBGET integrated database retrieval system