KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1303Help
Entry
THEYE_A1303       CDS       T00775                                 

Definition
(RefSeq) cytochrome c551 peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
tye  Thermodesulfovibrio yellowstonii
Brite
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     THEYE_A1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Paired_CXXCH_1 DUF1924
Motif
Other DBs
NCBI-GeneID: 6941305
NCBI-ProteinID: YP_002249115
UniProt: B5YFR7
Position
complement(1262413..1263492)
Genome map
AA seq 359 aa AA seqDB search
MLRRNSILIFLCLIALFFNIEGFASEKKKKKIQPLPAVPVPENNPMTQEKIELGKKLFFD
RRLSGDGTTSCASCHDPEKAFTDASEISLSYPTTRNFRNAPTLMNSAYAKHLFWDGRAKT
LEEQAEFPIMSPFEMNQNLDFVEEEIRIVPEYREAFKRIFGQDVNIKLIAKAIAAFERTL
ISKNAPIDRYLKGDKNALSSEAKKGLEIFTGKGKCIDCHYGYYLSDQEFHALMVPENPKY
ANEDKFIVTRRYVAKINKYPDYMNIKEDLGRYFKTKKQKDYKAFKTPTLREVAKTAPYMH
NGIFKSLDEVIDFFNKGGGEGNKVLKPLNLTEEEKKVLKTFLVEALSGEDLKIKPPDIP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaagaaatagtattttaatttttttatgcttgattgccttgttttttaatatt
gaaggctttgcttctgaaaaaaagaaaaagaaaattcagcctttgccagcggtgcctgtt
cctgagaataacccaatgactcaggaaaaaatagaacttggtaaaaagctgttttttgac
agaagactttcaggcgatggaacaacaagttgtgcaagctgtcatgaccctgagaaggca
tttacagatgcctctgagatatctctaagttatcccaccacaagaaactttaggaatgct
ccgactcttatgaattctgcttatgctaaacatcttttctgggatggacgagctaaaaca
ttagaagaacaggcagagtttcccattatgtcaccttttgaaatgaatcaaaatcttgat
tttgtagaggaagaaattagaatagtgcctgaatacagggaagcatttaagaggattttt
gggcaggatgtaaatattaaattgattgcaaaggctattgctgcttttgaaagaactcta
atttcaaaaaatgcacctattgacagatacctcaaaggagataaaaacgcattatcttct
gaagctaaaaaaggacttgaaatatttacaggtaaaggaaaatgcatagattgtcattat
ggttattacttaagtgatcaggaatttcatgcgcttatggttcctgaaaatccaaaatat
gctaatgaagacaaatttattgttacaagaagatatgtagcaaagataaataaatatcca
gactacatgaatatcaaggaagacctcgggagatatttcaaaaccaaaaaacaaaaagat
tataaagcgtttaaaacacctacattgagagaggttgcaaaaactgctccatatatgcat
aatggtatattcaagagtcttgatgaagttatagacttttttaataagggtggaggagaa
ggtaataaagttttgaaacctcttaacttgactgaagaagagaaaaaagttttaaaaaca
tttcttgttgaagccctgagtggcgaagatttaaaaataaaaccacctgatattccataa

DBGET integrated database retrieval system