KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1334Help
Entry
THEYE_A1334       CDS       T00775                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    THEYE_A1334
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    THEYE_A1334
Enzymes [BR:tye01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     THEYE_A1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1294093..1295526
Genome map
AA seq 477 aa AA seqDB search
MENLMNLIIARLDGEKINDSLYTHYIEKLVKEGIAGFIVFGGDYDEIKNFIDYLQSIASE
PLIIASDIERGVGQQIKGGSLIPSQMGIAAGFDLKENRQELESLYSIVIKEALDVGINLA
LIPVLDVNREPKNPIICTRAFSDNPEIVSEYGKFVIKLFESYGLSTCGKHFPGHGGTQID
SHLELPYLIYEIEIHLKPFKEAIKAKVSSIMVGHIVADDMKPASLSENVINKLLKQNMCF
NGAVLTDAMNMRALIDYENPHALALIAGADIILHPEQPYTALEEIKKAYMQGLISDRRIK
EAYRRIKRLKKLKTKKTIINNEDISLIHKAFKKTVTVIKNEINDLNSKKIVPYLTGVYTE
EIKKVFQNYFGSAYDLQDYRKSNAIPLIAAFTNIKAAGKEYVLKSQQNMIIKEIISNTDA
IVVSFGNPYVLRPFKKAKAIISLYDSHEHAVLAFLDVFNEGFKNTGRLPIKIEWLDD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttaatgaatttaatcatagcaaggcttgatggtgaaaaaataaatgattcc
ctatacacacactatattgaaaaacttgttaaagaaggaattgcaggtttcatagttttt
ggtggagactatgatgaaataaaaaatttcattgactatcttcaaagcatagcatcagaa
ccattaatcattgcttcagacattgaaagaggtgttggacagcagataaaaggtggaagt
ttgattccctcacagatgggaattgccgcaggatttgatttgaaggaaaacagacaggaa
cttgaatctctgtattcaattgtaataaaagaagcattggatgtgggaataaatcttgca
cttattcctgttttggatgtgaatagagagcctaaaaatccaataatatgcacaagagct
ttttcagataatcctgaaattgtttcggaatatggcaaatttgttataaaactctttgaa
tcttacggattatcaacatgcggaaaacattttccaggtcatggtggaacacaaatagac
tctcatctggaacttccttatcttatatatgaaattgaaatacatcttaaaccatttaag
gaagcaattaaagctaaggtttcttcaattatggttggtcatatagttgctgatgatatg
aaacctgcgtctctttcggaaaatgtgatcaataaattgctaaaacagaacatgtgtttt
aatggagcagttcttacagatgcgatgaatatgagagctttaatagattatgaaaatcct
catgctttagctcttatagcaggagcagatataattctacatccagaacaaccatatact
gctttagaagagataaaaaaagcttatatgcagggcttaattagtgacagaagaataaaa
gaagcttacagaagaattaagaggttaaaaaagctcaaaacaaaaaaaacgattattaat
aatgaagatatttccttaattcataaagcatttaaaaaaacagttacagttataaaaaat
gaaataaatgatttgaattctaagaaaatcgtcccttatcttacaggagtctatactgag
gaaataaaaaaagtatttcagaactattttggttctgcctatgatttacaggattataga
aaatcaaatgcaatacctttaattgcagcattcacaaatattaaggctgctggaaaggaa
tacgtattaaaatcgcaacaaaacatgataattaaggaaatcatatcaaatacagatgca
attgttgtatctttcggtaatccctatgttttaagaccttttaagaaagcaaaggctata
atttcactttatgattcccatgaacacgctgtgcttgcttttctggatgtattcaatgaa
gggttcaaaaatacgggcagactccctatcaaaatagaatggcttgatgactaa

DBGET integrated database retrieval system