KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1334Help
Entry
THEYE_A1334       CDS       T00775                                 

Definition
beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tye00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:tye00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1294093..1295526
Genome map
AA seq 477 aa AA seqDB search
MENLMNLIIARLDGEKINDSLYTHYIEKLVKEGIAGFIVFGGDYDEIKNFIDYLQSIASE
PLIIASDIERGVGQQIKGGSLIPSQMGIAAGFDLKENRQELESLYSIVIKEALDVGINLA
LIPVLDVNREPKNPIICTRAFSDNPEIVSEYGKFVIKLFESYGLSTCGKHFPGHGGTQID
SHLELPYLIYEIEIHLKPFKEAIKAKVSSIMVGHIVADDMKPASLSENVINKLLKQNMCF
NGAVLTDAMNMRALIDYENPHALALIAGADIILHPEQPYTALEEIKKAYMQGLISDRRIK
EAYRRIKRLKKLKTKKTIINNEDISLIHKAFKKTVTVIKNEINDLNSKKIVPYLTGVYTE
EIKKVFQNYFGSAYDLQDYRKSNAIPLIAAFTNIKAAGKEYVLKSQQNMIIKEIISNTDA
IVVSFGNPYVLRPFKKAKAIISLYDSHEHAVLAFLDVFNEGFKNTGRLPIKIEWLDD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttaatgaatttaatcatagcaaggcttgatggtgaaaaaataaatgattcc
ctatacacacactatattgaaaaacttgttaaagaaggaattgcaggtttcatagttttt
ggtggagactatgatgaaataaaaaatttcattgactatcttcaaagcatagcatcagaa
ccattaatcattgcttcagacattgaaagaggtgttggacagcagataaaaggtggaagt
ttgattccctcacagatgggaattgccgcaggatttgatttgaaggaaaacagacaggaa
cttgaatctctgtattcaattgtaataaaagaagcattggatgtgggaataaatcttgca
cttattcctgttttggatgtgaatagagagcctaaaaatccaataatatgcacaagagct
ttttcagataatcctgaaattgtttcggaatatggcaaatttgttataaaactctttgaa
tcttacggattatcaacatgcggaaaacattttccaggtcatggtggaacacaaatagac
tctcatctggaacttccttatcttatatatgaaattgaaatacatcttaaaccatttaag
gaagcaattaaagctaaggtttcttcaattatggttggtcatatagttgctgatgatatg
aaacctgcgtctctttcggaaaatgtgatcaataaattgctaaaacagaacatgtgtttt
aatggagcagttcttacagatgcgatgaatatgagagctttaatagattatgaaaatcct
catgctttagctcttatagcaggagcagatataattctacatccagaacaaccatatact
gctttagaagagataaaaaaagcttatatgcagggcttaattagtgacagaagaataaaa
gaagcttacagaagaattaagaggttaaaaaagctcaaaacaaaaaaaacgattattaat
aatgaagatatttccttaattcataaagcatttaaaaaaacagttacagttataaaaaat
gaaataaatgatttgaattctaagaaaatcgtcccttatcttacaggagtctatactgag
gaaataaaaaaagtatttcagaactattttggttctgcctatgatttacaggattataga
aaatcaaatgcaatacctttaattgcagcattcacaaatattaaggctgctggaaaggaa
tacgtattaaaatcgcaacaaaacatgataattaaggaaatcatatcaaatacagatgca
attgttgtatctttcggtaatccctatgttttaagaccttttaagaaagcaaaggctata
atttcactttatgattcccatgaacacgctgtgcttgcttttctggatgtattcaatgaa
gggttcaaaaatacgggcagactccctatcaaaatagaatggcttgatgactaa

DBGET integrated database retrieval system