KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1678Help
Entry
THEYE_A1678       CDS       T00775                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THEYE_A1678 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THEYE_A1678 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THEYE_A1678 (thrC1)
Enzymes [BR:tye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THEYE_A1678 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606840..1608087
Genome map
AA seq 415 aa AA seqDB search
MKYVKGLKCRECGREYPVEPIYVCEFCFGPLEAVYDYPKIKRALSRKVIEKRPKTLWRYK
ELLPIDGEPQAGLNSGFTPLVKAENLAKFLGVKELYIKDDTVAHPTLSFKDRVVAVALTK
AKEFGFDTVACASTGNLAHAVSAHGAKSGFHRFIFIPATLEQSKILASIVYEPNLVAVDG
NYDDVNRLCSEIANKYRWAFVNINIRPFYAEGSKTIGFEIVEQLGWDTPDSIVVPCASGS
LLTKVWKALKEFKEIGIIKDVDTKIYGAQATGCSPISTAFKQGTDVIRPVKPNTVAKSLA
IGNPADGYYALQAVRESGGAMEDVSDDEIIEAIKILSRTEGIFAETAGGVTLATYIKLLK
EGKIDKKDCTVLCITGNGLKTAEVLNGKTAEVYQIKPNLASFEEALKRIKQKEEK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaaagggacttaaatgcagggagtgtggaagagaataccctgttgagccc
atatacgtatgtgaattctgtttcggaccccttgaggcagtctatgattatccaaaaata
aagagagctttatcaagaaaagttatagaaaaaagaccaaaaacactctggagatataaa
gaacttctacccatagatggagaaccacaagcggggcttaattcaggatttacacctctt
gttaaagctgaaaatcttgcaaaatttcttggtgtaaaggaactttatataaaggatgac
acagttgcccatccaaccctttctttcaaagacagggttgttgcagttgctctcaccaag
gcaaaggagttcggttttgatactgttgcctgtgcttcaacaggtaatcttgcccatgct
gtatctgcgcatggtgcaaaatcaggttttcatagatttatttttattcctgctaccctt
gaacagagcaaaattcttgcatccattgtttatgagccaaatttagttgctgtagacgga
aactatgatgatgtaaacagactatgtagtgaaattgcgaataaatacagatgggcattt
gtaaatataaatattcgtcctttttatgcggaagggtcaaaaactataggatttgaaata
gttgaacaacttggatgggacacacctgatagcattgttgttccctgtgcaagtggttca
cttcttacaaaagtatggaaagctcttaaggaatttaaagaaattggcattattaaggat
gtagacacaaaaatatacggtgctcaagcaactggatgttcacctatatcaacagccttc
aagcagggtacagacgtaataagacctgtaaaaccaaatacagtagccaagtctcttgct
attggtaatcccgcagatggatactatgctttacaggctgtgagagaaagcggaggagca
atggaagatgtatctgatgatgaaataattgaagcaatcaaaatactttccagaactgag
ggaatttttgcagaaactgcaggaggagtaacacttgcaacatatattaaacttttgaag
gaaggcaaaattgataaaaaggattgcacggtgctctgtatcactggcaatggacttaaa
acagctgaggttttaaatggtaaaacagctgaggtttatcagattaaaccaaatcttgct
tcctttgaagaagccttaaagagaatcaaacaaaaggaggagaaataa

DBGET integrated database retrieval system