KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1678Help
Entry
THEYE_A1678       CDS       T00775                                 

Gene name
thrC1
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THEYE_A1678 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THEYE_A1678 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THEYE_A1678 (thrC1)
Enzymes [BR:tye01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THEYE_A1678 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606840..1608087
Genome map
AA seq 415 aa AA seqDB search
MKYVKGLKCRECGREYPVEPIYVCEFCFGPLEAVYDYPKIKRALSRKVIEKRPKTLWRYK
ELLPIDGEPQAGLNSGFTPLVKAENLAKFLGVKELYIKDDTVAHPTLSFKDRVVAVALTK
AKEFGFDTVACASTGNLAHAVSAHGAKSGFHRFIFIPATLEQSKILASIVYEPNLVAVDG
NYDDVNRLCSEIANKYRWAFVNINIRPFYAEGSKTIGFEIVEQLGWDTPDSIVVPCASGS
LLTKVWKALKEFKEIGIIKDVDTKIYGAQATGCSPISTAFKQGTDVIRPVKPNTVAKSLA
IGNPADGYYALQAVRESGGAMEDVSDDEIIEAIKILSRTEGIFAETAGGVTLATYIKLLK
EGKIDKKDCTVLCITGNGLKTAEVLNGKTAEVYQIKPNLASFEEALKRIKQKEEK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtaaagggacttaaatgcagggagtgtggaagagaataccctgttgagccc
atatacgtatgtgaattctgtttcggaccccttgaggcagtctatgattatccaaaaata
aagagagctttatcaagaaaagttatagaaaaaagaccaaaaacactctggagatataaa
gaacttctacccatagatggagaaccacaagcggggcttaattcaggatttacacctctt
gttaaagctgaaaatcttgcaaaatttcttggtgtaaaggaactttatataaaggatgac
acagttgcccatccaaccctttctttcaaagacagggttgttgcagttgctctcaccaag
gcaaaggagttcggttttgatactgttgcctgtgcttcaacaggtaatcttgcccatgct
gtatctgcgcatggtgcaaaatcaggttttcatagatttatttttattcctgctaccctt
gaacagagcaaaattcttgcatccattgtttatgagccaaatttagttgctgtagacgga
aactatgatgatgtaaacagactatgtagtgaaattgcgaataaatacagatgggcattt
gtaaatataaatattcgtcctttttatgcggaagggtcaaaaactataggatttgaaata
gttgaacaacttggatgggacacacctgatagcattgttgttccctgtgcaagtggttca
cttcttacaaaagtatggaaagctcttaaggaatttaaagaaattggcattattaaggat
gtagacacaaaaatatacggtgctcaagcaactggatgttcacctatatcaacagccttc
aagcagggtacagacgtaataagacctgtaaaaccaaatacagtagccaagtctcttgct
attggtaatcccgcagatggatactatgctttacaggctgtgagagaaagcggaggagca
atggaagatgtatctgatgatgaaataattgaagcaatcaaaatactttccagaactgag
ggaatttttgcagaaactgcaggaggagtaacacttgcaacatatattaaacttttgaag
gaaggcaaaattgataaaaaggattgcacggtgctctgtatcactggcaatggacttaaa
acagctgaggttttaaatggtaaaacagctgaggtttatcagattaaaccaaatcttgct
tcctttgaagaagccttaaagagaatcaaacaaaaggaggagaaataa

DBGET integrated database retrieval system