KEGG   Thermodesulfovibrio yellowstonii: THEYE_A1699Help
Entry
THEYE_A1699       CDS       T00775                                 

Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tye  Thermodesulfovibrio yellowstonii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tye00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THEYE_A1699
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    THEYE_A1699
Enzymes [BR:tye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     THEYE_A1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630820..1632628
Genome map
AA seq 602 aa AA seqDB search
MSSIKGYYGKLLYINLTTGKIEKREIPEEDLAKFIGGRGLGVKILWNHLQKPGVDPLSPE
NPLIFMTGPFSGFPVPSSSRTCVVTKSPITSPVHSPYPHASTLTYSNIGGFFGPELRFAG
YDGIVITGKANSLCYIVIDDDKVEIRDAKKFKGMRTDAFDKAILEELKDRRYKTVYIGPA
GENLVRYASILHTSTRAAGRGGVGCVMGSKNLKAIAVKGSKQPDVAHHKKFIEILEKARL
VLNNSPNTKNWRSYGTAGYIVKSSDQGTETVRNFREGTFPEAYKIGAEAARRDVWVRDIA
CMYCPLACKKSGRTKGKYGGIVHDGPEYETGTMLGSNLLISDMAGLLKIIYNVDDLGLDA
ISTGAVIGFLMEAYEKGMINRKFLDGIELKWGSVDATLAIVQKIAYRDGIGDLASKGVKA
LFQKIGQGSEKFAIHVKGLELAAHNIQANPPRALCYATANRGGCHLNGDSVEAQNFRAMI
DSTGVCLFAAMDKVYEEPIISMLSAITGVEYDRAQFLKAGERVFNLEKLFNYCEGFRRED
DWLPDRFFEDAFTIGPKKGAVLDRAKFRDMLTQYYKERGWDPETTKPTEAKLKELELDKI
IS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaattaagggatattatggtaaattgctttacataaaccttacgaccggcaag
attgaaaaaagggaaatccctgaggaagaccttgccaaatttatcggaggacggggttta
ggagtaaaaattttatggaatcatctgcaaaaacccggagttgacccactttcccctgaa
aatcctctcattttcatgacaggtcccttttctggatttcctgttccttcttcatcaaga
acctgtgtggttacaaaatcacctataacatctcctgtgcattctccctatccacatgca
tcaactctcacatactcaaatattggtggattcttcggtcctgagcttaggtttgcaggt
tatgatggaattgtaattactggtaaagcaaactctctctgctacattgtgatagatgac
gataaggtagaaattcgtgatgctaagaaatttaaaggcatgcggacagatgcctttgac
aaggcaattttggaagaactcaaagatagaagatataaaacagtatacattggaccagct
ggtgaaaatcttgtccgatatgcctccatacttcacacttctacccgtgcagcaggtcgt
ggcggggtgggatgtgttatgggttcaaaaaatttaaaagctattgcagtaaagggaagt
aagcagcccgatgttgctcatcataaaaaatttattgaaattcttgaaaaagccagatta
gtgttaaacaactctcctaatacaaaaaactggagatcctatggaacagctggctatatt
gtaaaaagtagtgatcaaggcacagaaacagtgcgtaacttcagagaaggcactttcccg
gaagcatataaaattggtgcagaggcagcaagaagggatgtctgggtaagggatattgcc
tgtatgtattgcccacttgcctgcaaaaagagcggccgcacaaagggtaaatatggtggt
attgttcatgatgggccagagtatgaaaccggaacaatgcttggctctaatcttttaata
tcagacatggctggtttactcaagataatctataatgttgatgaccttggtttagacgca
atttcaactggagcagttatcggatttctaatggaagcctatgaaaagggaatgattaat
agaaaattccttgacggaattgagcttaaatggggaagcgttgatgcaacccttgccata
gtacaaaaaattgcatacagagacgggatcggagaccttgcctcaaagggtgtaaaggca
ttatttcaaaaaattggtcagggtagtgaaaagtttgccatacatgtaaaaggacttgag
cttgctgcccacaacattcaagcaaatccgccaagagcactctgctatgctactgcaaac
aggggtggatgtcacttaaatggtgacagtgttgaagcgcagaattttagggctatgatt
gactcaacaggagtatgtttattcgctgccatggataaagtctatgaagaaccaataatt
tccatgctcagtgcaataacaggagttgaatatgacagagcacagtttcttaaggcagga
gagagagtctttaacttagaaaagctcttcaactactgtgagggcttccgaagagaagat
gattggttacctgaccgcttttttgaagatgccttcacaataggaccgaaaaaaggtgct
gtacttgatagggctaagttccgtgacatgctaactcaatattacaaagaaagaggttgg
gatcctgaaaccaccaaacctacggaggctaaattaaaggaacttgagctggataaaatt
attagttag

DBGET integrated database retrieval system