KEGG   Candidatus Uzinura diaspidicola: ASNER_007Help
Entry
ASNER_007         CDS       T02439                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
udi  Candidatus Uzinura diaspidicola
Pathway
udi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
udi01100  Metabolic pathways
udi01110  Biosynthesis of secondary metabolites
udi01130  Biosynthesis of antibiotics
udi01230  Biosynthesis of amino acids
Module
udi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:udi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ASNER_007 (trpC)
Enzymes [BR:udi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ASNER_007 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AGC66799
UniProt: L7VJC2
Position
complement(7607..8395)
Genome map
AA seq 262 aa AA seqDB search
MNILEKIIEVKRKLLSIKRSQFPIDYLEKSRYFNRETYSLSRKISKKSIGIIAEFKRESP
SKGLLNNYNLPVEKVIIGYKKAGVIGISILTDLTYFKGKEQDLIKTRKIVQLPLLYKDII
IDEYQVLLAKAIGSDIILLIAEVLSKKKIRTLIQTAKSLGLEVLMELHSERELYKMNEEL
IMIGVNNRDLRSFSINIESSIELSKRITEKFKISESGIYDPYQITFLHKKGFNSFLIGEN
FMRTEDPGKSCEHLIKKINDNQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacttgaaaaaataatagaagtaaaacgtaaattattgtcaataaaaagaagt
caatttcctattgattacttagaaaaaagtcgctattttaatagagaaacttattcttta
tccagaaaaatttcaaagaaatctataggaataatagcagaatttaaaagagaatctcca
tctaaaggattacttaacaactataatttacctgtagaaaaggtaattataggctataaa
aaggcaggggttatagggatttccatcctaaccgacttaacctattttaaaggtaaagag
caagatcttataaagacaagaaaaattgtacaactacctttattatataaagatattatc
attgatgaatatcaagttttactagcaaaagctataggatcagatattatactgctgatt
gcagaagttctctctaaaaaaaaaataagaacactaatacaaacagcaaaatcattaggg
ttagaagtattaatggaattgcattcagaaagagaactatataaaatgaatgaagaactt
attatgattggagtgaataatagagatcttagatctttttcaataaatatagaaagttct
attgaactttctaaaagaattactgaaaaatttaaaatatcagaaagtggtatttacgat
ccttatcagattacttttcttcataaaaaggggttcaatagttttcttattggtgaaaac
tttatgcgtactgaagatccaggtaagtcgtgcgaacatttgataaaaaaaataaatgat
aaccaataa

DBGET integrated database retrieval system