KEGG   Ustilago maydis: UM00130.1Help
Entry
UM00130.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
uma  Ustilago maydis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:uma00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 240 aa AA seqDB search
MSVLKTLVINPRSGVKPTATLFFLHGLGDSSAGWSDVAQMLSQRPSLSHVRFVLPNAPIQ
PVTLNMGMPMPSWFDILALDDLSGAEDEAGLLKSTDEIKKLIKAENDGTAKDLDGHKIPS
ERIVVGGFSQGGAISLLTGLTNPTPVAGVAALSTWLPLRAKIATLRTPTSKTLKVFQAHG
DADPVVKYEYGQRTVDFLKNELALNDKDVEFHTYPRMPHSACPEEIRDLAAFLEKVIPAQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgctcaagacactcgtcatcaacccacgctcgggcgtcaagcccactgcgacc
ctcttcttcttgcatggtcttggagactcgagtgccggctggtctgacgtcgcacagatg
ctctcgcagcgcccttcgctgtcgcacgtccgtttcgttctgccgaatgctcccatccag
ccagtgacgctcaacatgggcatgccaatgccttcgtggttcgatatccttgccctcgac
gacctgtcgggagccgaagatgaagctggcctgctcaagtcgaccgacgaaatcaagaag
ctcatcaaggccgagaacgacgggactgcgaaggacctagatggacacaagatccccagc
gaacgtattgtggtaggcggcttcagtcaaggcggcgcaatttcgcttctcaccggtctc
accaatcccaccccggtggcaggtgttgccgcactctcgacgtggctacccctgcgtgcc
aagatcgccaccctgcgaactcccacatccaagacgctcaaggtgtttcaggctcatggg
gatgcagatcccgtggtcaagtacgagtatggtcaacgaaccgtcgatttcctcaaaaac
gaattggcactgaacgacaaagatgttgaattccacacttatccgcgcatgccgcactcg
gcgtgccccgaagagatccgtgacctggctgcctttttggagaaagtcattcccgctcag
tag

DBGET integrated database retrieval system