KEGG   Ustilago maydis: UM00130.1Help
Entry
UM00130.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
uma  Ustilago maydis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    UM00130.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     UM00130.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 240 aa AA seqDB search
MSVLKTLVINPRSGVKPTATLFFLHGLGDSSAGWSDVAQMLSQRPSLSHVRFVLPNAPIQ
PVTLNMGMPMPSWFDILALDDLSGAEDEAGLLKSTDEIKKLIKAENDGTAKDLDGHKIPS
ERIVVGGFSQGGAISLLTGLTNPTPVAGVAALSTWLPLRAKIATLRTPTSKTLKVFQAHG
DADPVVKYEYGQRTVDFLKNELALNDKDVEFHTYPRMPHSACPEEIRDLAAFLEKVIPAQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgctcaagacactcgtcatcaacccacgctcgggcgtcaagcccactgcgacc
ctcttcttcttgcatggtcttggagactcgagtgccggctggtctgacgtcgcacagatg
ctctcgcagcgcccttcgctgtcgcacgtccgtttcgttctgccgaatgctcccatccag
ccagtgacgctcaacatgggcatgccaatgccttcgtggttcgatatccttgccctcgac
gacctgtcgggagccgaagatgaagctggcctgctcaagtcgaccgacgaaatcaagaag
ctcatcaaggccgagaacgacgggactgcgaaggacctagatggacacaagatccccagc
gaacgtattgtggtaggcggcttcagtcaaggcggcgcaatttcgcttctcaccggtctc
accaatcccaccccggtggcaggtgttgccgcactctcgacgtggctacccctgcgtgcc
aagatcgccaccctgcgaactcccacatccaagacgctcaaggtgtttcaggctcatggg
gatgcagatcccgtggtcaagtacgagtatggtcaacgaaccgtcgatttcctcaaaaac
gaattggcactgaacgacaaagatgttgaattccacacttatccgcgcatgccgcactcg
gcgtgccccgaagagatccgtgacctggctgcctttttggagaaagtcattcccgctcag
tag

DBGET integrated database retrieval system