KEGG   Ustilago maydis: UM00215.1Help
Entry
UM00215.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
uma  Ustilago maydis
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UM00215.1
  Amino acid metabolism
   00330 Arginine and proline metabolism
    UM00215.1
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    UM00215.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     UM00215.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 544 aa AA seqDB search
MTGSHSVPATGPSHSHHANPPTSAASSSSKTIVIKLGTSSIISEETQLPKIAILSSLVET
CHKLRSLGHKVVIVCSGAIGMGRIRMHVNEKPKSLGERQALAALGQLRLIALWDSLFGTV
GIDVAQVLLTRNDIADRPRYNNARTTLNTLISAPFNAIPIVNENDTVSVSELRFGDNDTL
SAITAGLVDADFLFLCTDVDGLYTGNPRSDPNARRLGVVEDVAAARKAVSVATMGSSFGT
GGMQTKLIAAELATAAGVATVIINGEHPENMIKVVAKGIPSIGTESTSLRMDSLASSVSS
LASDEKELIGYPPLDSPAHTIFLPKANPLSSRKWSILHALHPAGALIIDEGAFKRIARAD
SGGRLLPAGVVGVEGNWERMQAIRLVVRRRISKAIPHATGLEQGAPLSNSTPIARSLGQY
LLRNDTDSVSGTRTPPVIDSLRKGSVAAASVPSSPSSTAASPADAAAHATTSQSTLTKDG
DQDWEWQLIEVGRALANYTSIESERIKGLKSSQISSTLGYADSEYLTDQVALHTLSLPDP
YPSQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacaggatcgcacagcgtccccgcaacgggtccttctcactcgcaccatgctaatcct
ccaacctcggccgcctcctcctcttccaagacaatcgtaatcaagctcggcacctcctca
atcatttccgaagaaacacagctcccgaaaatcgccattctttcttcgcttgtcgaaaca
tgtcacaaactgcggtctcttggtcacaaggtcgtcattgtctgttctggagccattggg
atgggacgaatccgaatgcatgttaatgaaaagcccaagtctctcggtgaacgacaagcg
cttgccgcgctcggccagctacgactcatcgccctttgggactcgctcttcggcactgtg
ggcatcgacgtcgcacaggttctcctcactcgaaacgatatcgccgatcgacctcggtat
aacaacgcacgaactacactcaacactcttatatccgcgccattcaatgccatccctatc
gtgaacgagaacgatacagtgtcggtatcagagttgaggttcggtgacaatgacacatta
tcagcgattacagccgggctggtagacgccgactttctatttctgtgcacagatgtagat
ggcctgtacacgggtaacccgcgcagcgatccaaatgccaggcgattgggtgttgtagag
gacgtagcagctgcacgcaaagcggtctcggtagcgacgatgggttcgagttttggtacc
ggtgggatgcagaccaagctgattgctgcggagttggccacagcggcaggtgttgctact
gtgattatcaacggtgaacatccggaaaacatgatcaaggtcgtggccaagggtattccg
tcaatcggaacggaaagtacgtcgttgaggatggactcgttggcttcgtcggtgtcgtcg
ttggcatcggacgagaaggaactgatcggatatccgccgttagacagcccggcgcatacg
atcttcctgccgaaagcgaatccgttatcttcgaggaaatggagcattttgcacgccttg
catccagcaggcgcactgatcatcgacgaaggcgcctttaaacgcatagctcgtgctgat
tctggtggacgattgttgcctgcaggtgtggtaggggttgagggtaactgggaacgcatg
caggctattcgtttggtggtgcgacgtcgcatctccaaagcgatcccccacgccacgggg
ttggagcaaggcgcaccgctgagcaactcaactcccatcgctcgaagtttgggtcagtac
ctcttgaggaacgatacagactcggtctcaggtacaagaactccaccggtcatcgattcg
cttagaaagggctctgtcgcagctgcatctgtgccgtccagtccatccagcacagccgct
tcgccagcagatgcagcagcacatgcaaccacatcacagagcaccttgaccaaagacggc
gaccaagactgggaatggcagctgatcgaagtaggaagggccctagccaattacacctcg
atcgaaagcgagaggatcaaaggcttgaaatcttctcaaatctcatccacgttaggatac
gctgactccgagtatttgaccgatcaggtggctttgcatactctttccctgcccgatcct
tacccttcgcaatga

DBGET integrated database retrieval system