KEGG   Ustilago maydis: UM00298.1Help
Entry
UM00298.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 860 aa AA seqDB search
MACPHLTAAFSALTPPRPSQHVHKEECTLCFDDQDGPNGIDVCLLCFNGACTGNGDREHS
RLHYEKTQHALVVNIRRTRRPTPPASQAEASTVPKKLAIAAESDADKYDYHTVPKCLACD
PTGHGKELPITDKLDQVIRGVMTAMSSAQQSEVKAWEEEIVACQHTRELVQPGEQMKLEP
SGLALCGKCELTSNLWLCLTCGHLGCGRAQFGGVGGNSHGLAHFQETGHPVSVKQGTITA
EGSADIYCYACNDARIDPNLSQHLSHFGINVMDLSKTEKSMTELQIEQNLKFDFNMTGDD
GKVLEPAFGPGLTGLRNLGNSCYMASVLQSVFSLSAFKTRYGDAYRPHSLACTNMPATCF
ECQITKLADGLLSGRYSYPREPDQSGSAWIHAAGSADEQQQQQQSLFQKGIRPSMFKALV
GKGHEEFSTMRQQDADEFLKYLVGVVQKENRKLASSGSSLHTDDPTTVFGFGLEQRLECN
TCHKVRYSVERQDAGLSLPVPIRRKAAEQHVSAGKRPVEGLGAAESTVSNSESASASAVC
NDAEEYEPVSLVECLDLFTAPEELEYNCPSCCTKVTATKRTLFSTFPDVLALQVQRFQLL
NWVPQKVAVRIVVPIDTPLDLDRYLGRGKQPHEEELGEDQSDSSSANGGEPEWDVGVLSQ
LTSMGFAEIRCKKAVLATRMGDAESAMNWLFAHMDDADIDDPIDFGAESKRDAGVVGADT
SMLEEMGFSAAQARKALRLNSNNAELAVAWLFENAHDAGQDEHDVPEARAAVEGSTNSSV
IPGNSQLPATYTCTSFISHKGPSVHSGHYVAHVKQRDHTWVLFNDEKVVKAPLTCTVKQR
DNVGVDALSSHAYLYFFQRC
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtccgcatctcactgccgccttttcggcgttgacgccacctcgtccttcgcag
catgttcacaaggaagagtgcacactctgctttgatgaccaagatgggcccaacggaatc
gatgtctgcttgctctgcttcaacggcgcatgtaccggcaacggcgatcgcgagcattca
cgtctgcactatgaaaagacgcaacatgcccttgtcgtaaacatccgccgaacacgtcgt
ccgacccctccggcatcacaagccgaagcttcgacagtgcccaagaagctggcgatcgct
gccgaatccgatgccgacaagtacgactaccacacggtcccgaaatgccttgcttgcgat
cccaccgggcacggcaaggagctgcccatcacggacaagctcgaccaagtgattcgaggc
gtcatgactgccatgtcttcggctcagcagagcgaagtcaaagcctgggaggaagagatt
gttgcttgccagcacacacgagagctcgtacagcccggagaacagatgaaactcgagcct
tcagggcttgctttgtgcggcaagtgcgagctcacctcgaatctctggctttgcctcacg
tgtggtcacctcggctgtggtcgagctcagtttggtggcgtgggcggcaacagccacggt
ttggcgcatttccaagagactggccatccagtctcggtaaaacaaggcaccattaccgcc
gaaggtagcgcagacatctactgttacgcgtgcaacgatgctcgcatcgaccccaacctt
tcacaacacctctcccatttcggcatcaacgtcatggacctctccaagactgaaaagagt
atgacagagttacagatcgagcagaacctcaagttcgacttcaacatgaccggagatgac
ggcaaggtgctcgagcctgcctttggccctggactcaccggcctgcgcaacctaggcaac
agctgttacatggcatcggttttgcagagtgtgttttccttgtccgcattcaagacgagg
tatggggatgcctaccgcccgcattcgcttgcctgcaccaatatgccagccacatgcttc
gaatgtcagatcaccaagcttgctgatggcctcttgtctgggcgctactcgtatcctcgc
gagccagaccagagtggcagtgcatggattcacgcagctggaagcgcagatgagcaacag
cagcagcagcaatcgctgttccagaaaggcattcgaccaagcatgttcaaagccttggtc
ggcaagggacacgaagaattctcgaccatgcgacagcaagacgctgacgagttcctcaag
taccttgttggagtcgtgcagaaggagaaccgcaagctggcatcgtccggctcgtctttg
cacacggacgacccaacgacggtgtttgggtttgggttggagcagaggctcgagtgcaac
acgtgtcacaaagtgaggtatagcgtggagcgccaagatgctggactcagtctgccggtg
ccgatccgacggaaagcagctgagcagcatgtgtcggctggcaagcggcctgttgaggga
ctaggcgccgccgaatctactgtctcgaactcagaatctgcttctgcatccgcggtttgc
aacgacgcagaggagtacgagccggtgagcttggtcgagtgtctcgacctattcacggca
ccggaagagctggaatacaactgtccgtcgtgttgcaccaaagtgacggcgaccaagcgg
acgctgttctcgacattccctgatgtgctcgcgctgcaagtacaacgattccagctgctc
aactgggtacctcagaaagtggcggttcgcatcgtcgtgccgatcgacacgcctctcgat
ctcgatcggtaccttggccgtggtaaacagccacatgaagaggaattgggtgaggaccaa
agtgactcttcgagtgcaaatggtggagagccagagtgggatgtgggtgtgttgtcgcag
ttgacgagcatggggttcgccgagatcaggtgcaagaaggcagtgctagctacgcggatg
ggcgatgcggagagtgcgatgaactggctgtttgcgcatatggacgatgctgacattgac
gatccaatcgactttggcgccgagtcgaagcgtgatgcgggagttgtaggggccgacacg
tcgatgctcgaagaaatggggttcagcgcggcgcaggcacgaaaagccctgcggttgaat
tcgaacaatgccgaactagccgttgcgtggctgtttgaaaacgcacatgatgcaggccaa
gacgagcatgatgtaccagaggctcgtgcagccgtcgagggctcgacgaactcaagcgtg
attccaggcaattcccaactacccgccacgtacacctgcaccagctttatcagccacaaa
ggccccagtgttcacagtggacactacgtcgcccatgtcaaacagcgcgatcacacctgg
gtcctgttcaacgacgaaaaggtggtcaaggctccactcacttgcactgtcaagcaacgc
gacaatgtcggtgtcgacgccttgagttcgcacgcctacttgtactttttccagcggtgt
tag

DBGET integrated database retrieval system