KEGG   Ustilago maydis: UM00376.1Help
Entry
UM00376.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.4.19.12]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UM00376.1
Peptidases [BR:uma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UM00376.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1066 aa AA seqDB search
MSFNWKGLLGVNQTSTSSSLGSPGTSVSNNASPASSSNGTSHVTSTSGATTHTTASSISA
GSTAMSPVGPRAPLNANPYSLTQPSAPSAPLFGGMMPGSTSHHSTSYIPSSSSTTQSSVI
SRKPSEIPVNAAEGGGYLLGMENFGNTCYVNSVIQSLYFCRPFRDSVLSYKPSGRDRSGS
DLSSTGGVHSVGDLASRTPPDTATQVIDGVPPSDTLFASLRDLFEVIQQSGYQKALSSPT
RSTAPAPLPLASPISPSPPATGTAEYPSIARKTSIRGRPSTAGASSARVGAGNHLVSSAS
VGAGATAAQAIPIMPNSVAGSGPPNLSISTSSAGTLASGFPSVDSGAVKSFLTTLKRENV
LFDSTMHQDAHEMLNFVLNKVGEDLIDADKAKSRVKSQSRDAYPNSRNMRNGSDKTVDVQ
RKRNVMEVAPNGKTCVHRLFEGVLTNETRCLTCETVTSRDECFLDLSIDIDKNSSVTSCL
RQFSASEMLRSRNKFFCDSCSGLQEAEKRMKIKKLPNVLALHLKRFKYEETVQRYVKLAY
RVVFPLELRLFNTSDDAEDPDRLYELCAIVVHIGAGPHHGHYVAVIKVGGRWVQFDDDVV
TYIDEAELTKYYGDRPGLGSAYVLFYQAVDLDFEGLGLEDPALQASTQQRVVAGAASEAR
GRAGLKVPGGADPRSNISPDRSGAAATANQTRLNSVTEGSPLVSAGTGQPEAQGGNSWFG
SFRKRAGSQSRRRPKTMSSMDVVTGGLSGLPELSASTAHGDLARQAVAEVDSTTPDNASV
STHSTTANDAASRVTPIKTSSSMPPATEHSALPSMHPLPSRTDSPSAGTEAAAPMRNALL
PMTTASASVLDANATRATTESPSESKYVRMMANQSDAAANRETREQNLRRGEMNRRARAA
SEGFPSSGILSEAAISSGPFVTGPKDGTRVLLTPTAVVPNTLAASSSIAPQREASSGSGF
APLERFLSSKTQKSQAKMARRASSSYTPLSPTTDKGERKEGMLLNLFNSSSPSASSAAQS
KRNSMQHLSNGSTNVVGGAEDTGLPTRKSSISTRTFSKTFGFGRKS
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttaactggaaaggccttttaggcgtaaatcagacttccacctcctcatcactt
ggctctcctggcacttctgtatccaacaatgcctctcccgcatcgagctccaacggcaca
agtcatgtcacatcgacttcgggcgccaccactcacacgacagcttcgtccatatcggct
ggctcgaccgccatgagtccagttggaccgcgcgcaccgctcaacgccaatccgtactct
ttgacacagccctcagccccgagcgcacctctgttcggaggcatgatgcccggatcgact
tcacatcacagcaccagctacattccctcttcgtcctcaaccacgcagtcctcggtcata
tctcgtaaaccgtccgagatccctgtgaatgcagccgaaggaggaggatatctgcttggc
atggaaaactttggcaatacgtgctacgtcaactcggtaatccagtcgctctacttttgt
cgtcccttccgcgactcggtgctcagctataaaccttcaggtcgagatcgatccgggtcg
gatttgagcagtacgggtggtgtccactccgtcggcgatctcgcttctcgcactccacca
gatactgcaacgcaagtcatcgacggcgtgcctccctcggatactctttttgcgtcgctg
cgcgacctcttcgaggttatccaacagtcaggctatcagaaagcattgtcatcgcctacc
agatctacagctcctgctccactgcccctcgcgagccccatttcgccttctcctcccgca
acaggcactgcagagtatccgtccattgccaggaaaacttccatccgtggtcgcccttct
accgctggcgcttcctcagccagagtcggtgcaggcaaccatctcgtctcttctgcttct
gttggtgccggtgctacagccgctcaggccatccccatcatgcctaattcggtcgccggt
tcgggaccgcctaatctgtccatttcgaccagctcagcaggcacgctggcctccggcttt
ccttccgtggactcgggtgcggtcaagtcgttcctgactacgctcaagcgtgagaatgta
cttttcgacagcaccatgcaccaggatgcgcacgagatgctcaactttgtgctcaacaag
gtcggagaagatctcatcgatgctgataaggcaaagagccgcgttaaatcgcaaagtcgc
gatgcttacccgaattcgaggaatatgaggaatggctcagacaagacggtcgacgtgcaa
cgcaagcgcaatgttatggaggtggctcctaatggcaagacatgcgtacatcgccttttc
gaaggcgtattgaccaatgagactcgctgcctcacttgtgagaccgtcacctctcgcgac
gagtgcttcttggatctttccatcgacattgacaagaattcgtctgtgacctcctgcttg
cgtcagttctcagcctcggagatgctgcgttcgcggaacaagttcttttgcgattcatgc
tcaggcttgcaggaagcagagaaacgcatgaagatcaaaaagcttcccaacgtgctggcg
ctgcatctcaagcgtttcaagtacgaggagacggtgcagcgttatgtcaaacttgcctat
cgcgtagttttcccgctcgagcttcggcttttcaatacatcggacgatgccgaagatccg
gatcgtctatacgagctctgtgccatcgtggttcacatcggcgcaggccctcaccacgga
cactacgttgctgtaatcaaagttggcggtcgctgggtgcagttcgacgacgacgtggtc
acctacattgacgaggcagagctcaccaagtactacggcgaccgccccggtctcggaagc
gcttacgtgctcttctaccaggcggtcgatctggactttgaaggccttggcctcgaggac
cctgcgcttcaagcgtcaactcagcagcgagtcgttgcgggcgcagccagcgaagctagg
ggcagagccggtctcaaagtgccaggtggtgccgatcctcgcagcaacatctcgcccgac
cgatcaggtgcagctgcaaccgcaaatcagacgcgtctcaattcggttactgaaggaagc
ccgcttgtttctgccggtacgggccagcccgaggctcaaggaggaaacagctggttcggg
tccttccgaaaacgcgccggcagccagtctcggagaaggccaaagaccatgtcctccatg
gacgttgtcacgggcggtctgtctggcctacccgaattgtcagcttcgaccgctcatggc
gacctcgcgagacaagcagtagccgaagtggacagtacgacacctgacaacgcctcggtt
tcgactcattcgactaccgccaatgatgctgcctcccgcgtaacacctattaagacctca
tcgtccatgcctccggctacagaacattctgctctgccatcgatgcaccctcttccgagt
cgcaccgattcgccgagcgctggaacagaggctgctgcaccgatgcgtaatgccttgttg
ccaatgactacggcatcagcatccgtcttagatgccaacgctacccgtgccactaccgag
tcacctagcgagtccaagtacgtacgcatgatggcgaatcagtcggatgctgcggccaac
cgtgaaactagggagcaaaacttgaggcgtggcgaaatgaatcgccgtgcgcgtgctgct
tccgagggctttccttcgtctggtattttgtcagaagcggcgatatctagtggcccgttc
gtaaccggaccgaaagatggtactcgagttttgttgacaccaactgcggtcgttcccaac
acgctggcggcgtcatcctcgatagcgccacaacgtgaggcgtcgtcaggtagtgggttc
gcgcctctggagcgtttcctgtcatccaagacacagaagtcacaagcgaagatggcacga
agagcatcatcgagctatacacccttgtcaccaacaacggacaagggcgagaggaaggaa
ggcatgttgttgaatctgttcaattcatcttcgccgtcggcctcgtcagcggctcagtcg
aaacgcaactcgatgcagcacctgtccaacggtagtacgaacgtagtcggtggagcggaa
gatacaggtcttccgacgcgcaagtctagtatctcgacgagaacgttcagcaagacgttt
gggtttggtcggaagagctga

DBGET integrated database retrieval system