KEGG   Ustilago maydis: UM00421.1Help
Entry
UM00421.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
uma  Ustilago maydis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:uma04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 424 aa AA seqDB search
MSAHPSNPHRTPYNVLNQTFLIDNAYAITKDLGQGAYGCVAAATHKGTGESVAIKKITNV
FTKKILTKRALREIKLLRHFRGHKNITCLYDMDIIDPVGFNEVYLYEELMEADLHAIIRS
GQPLSDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLICDFGLARGFETDPELAKQVG
AGFMTEYVATRWYRAPEIMLSFQNYTTAIDIWSLLGGRPIFKGRDYVDQLNQILHYLGTP
SEETLRRVGSPRAQDYIRSLPYQPRIPFDRLYPQANPQALNLLERMLEFDPAKRISCEEA
LQHPYLSVWHDPADEPVCPRKFDFGFESVDEVQGMKTLILEEVRSFRTEVRRQARLMQQP
KRQESLPIPSREDIQRSSPTEEGNPAYSVLGASAGIIQGATNSEHASGVLNDACSKDVGL
GSLG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacatccatcaaacccacaccgtacaccgtataacgtcctcaatcagacgttc
ctgatcgacaatgcctacgccatcaccaaggacctcggccagggtgcctacggttgcgta
gctgctgccacccacaagggcaccggcgaaagcgtagctatcaaaaagatcaccaacgtc
ttcaccaaaaagatcctcacaaaacgtgccttacgagagatcaaacttttgcgtcacttc
cgcggccacaaaaacatcacctgcctatacgacatggacattatcgaccccgtcggcttc
aacgaggtctatctctatgaagagctcatggaagctgatttgcatgccatcattcgatcc
ggccagcctttgtcggacgctcactttcagtcgttcatctatcaaacactgtgcggcttg
aagtacattcattccgcctcggtcttgcatcgagacctcaagcccggcaacttgctcatc
tgcgattttggccttgcacgtggcttcgagacggatccggaattggccaagcaggtgggc
gcaggtttcatgaccgagtacgtagcaactcgatggtatcgtgcaccagaaatcatgctc
agctttcagaactataccacagcgatcgacatctggtcgctcttgggaggacgaccgatc
ttcaagggtagggactacgtcgatcagctcaaccagattttgcactacttgggaacgccg
agcgaagagacgctccgacgcgttggatctccgcgtgcacaggactacattcgatctcta
ccttatcaaccgcgcattcctttcgatcgactatatccacaagccaaccctcaggcgctg
aacctgttggaacgcatgctcgagttcgaccccgccaaacgcatctcctgcgaagaggca
ctgcagcacccatacctgtcagtatggcatgaccccgctgacgaacccgtctgcccgcgc
aagtttgatttcggctttgaaagcgtcgatgaagtgcaaggcatgaagacgctcattctc
gaggaagtgcgtagcttccgaaccgaagttcgacgtcaggccagattgatgcaacaacca
aagaggcaagagtctttgcctattccaagcagagaggacattcagcggagcagtccaacc
gaggaaggcaatccggcctattcggtattaggtgcaagtgcgggcatcattcagggtgca
accaactcggagcatgccagcggcgtgctcaatgatgcgtgttcgaaagatgtaggactt
ggcagcttgggttga

DBGET integrated database retrieval system