KEGG   Ustilago maydis: UM00421.1Help
Entry
UM00421.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
uma  Ustilago maydis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:uma00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    UM00421.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     UM00421.1
Protein kinases [BR:uma01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   UM00421.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 424 aa AA seqDB search
MSAHPSNPHRTPYNVLNQTFLIDNAYAITKDLGQGAYGCVAAATHKGTGESVAIKKITNV
FTKKILTKRALREIKLLRHFRGHKNITCLYDMDIIDPVGFNEVYLYEELMEADLHAIIRS
GQPLSDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLICDFGLARGFETDPELAKQVG
AGFMTEYVATRWYRAPEIMLSFQNYTTAIDIWSLLGGRPIFKGRDYVDQLNQILHYLGTP
SEETLRRVGSPRAQDYIRSLPYQPRIPFDRLYPQANPQALNLLERMLEFDPAKRISCEEA
LQHPYLSVWHDPADEPVCPRKFDFGFESVDEVQGMKTLILEEVRSFRTEVRRQARLMQQP
KRQESLPIPSREDIQRSSPTEEGNPAYSVLGASAGIIQGATNSEHASGVLNDACSKDVGL
GSLG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacatccatcaaacccacaccgtacaccgtataacgtcctcaatcagacgttc
ctgatcgacaatgcctacgccatcaccaaggacctcggccagggtgcctacggttgcgta
gctgctgccacccacaagggcaccggcgaaagcgtagctatcaaaaagatcaccaacgtc
ttcaccaaaaagatcctcacaaaacgtgccttacgagagatcaaacttttgcgtcacttc
cgcggccacaaaaacatcacctgcctatacgacatggacattatcgaccccgtcggcttc
aacgaggtctatctctatgaagagctcatggaagctgatttgcatgccatcattcgatcc
ggccagcctttgtcggacgctcactttcagtcgttcatctatcaaacactgtgcggcttg
aagtacattcattccgcctcggtcttgcatcgagacctcaagcccggcaacttgctcatc
tgcgattttggccttgcacgtggcttcgagacggatccggaattggccaagcaggtgggc
gcaggtttcatgaccgagtacgtagcaactcgatggtatcgtgcaccagaaatcatgctc
agctttcagaactataccacagcgatcgacatctggtcgctcttgggaggacgaccgatc
ttcaagggtagggactacgtcgatcagctcaaccagattttgcactacttgggaacgccg
agcgaagagacgctccgacgcgttggatctccgcgtgcacaggactacattcgatctcta
ccttatcaaccgcgcattcctttcgatcgactatatccacaagccaaccctcaggcgctg
aacctgttggaacgcatgctcgagttcgaccccgccaaacgcatctcctgcgaagaggca
ctgcagcacccatacctgtcagtatggcatgaccccgctgacgaacccgtctgcccgcgc
aagtttgatttcggctttgaaagcgtcgatgaagtgcaaggcatgaagacgctcattctc
gaggaagtgcgtagcttccgaaccgaagttcgacgtcaggccagattgatgcaacaacca
aagaggcaagagtctttgcctattccaagcagagaggacattcagcggagcagtccaacc
gaggaaggcaatccggcctattcggtattaggtgcaagtgcgggcatcattcagggtgca
accaactcggagcatgccagcggcgtgctcaatgatgcgtgttcgaaagatgtaggactt
ggcagcttgggttga

DBGET integrated database retrieval system