KEGG   Ustilago maydis: UM00527.1Help
Entry
UM00527.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
uma  Ustilago maydis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UM00527.1
   00240 Pyrimidine metabolism
    UM00527.1
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    UM00527.1
   03410 Base excision repair
    UM00527.1
   03420 Nucleotide excision repair
    UM00527.1
   03430 Mismatch repair
    UM00527.1
   03440 Homologous recombination
    UM00527.1
DNA repair and recombination proteins [BR:uma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      UM00527.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 170 aa AA seqDB search
MPPKSSNQKSLSFKAQSKPKSTYSASAKDQLKTKANLKTSTPNKPLTSSLVRKPSPTCTA
TSKQDSEYANRKDLDVDDERWDGVWRTTKKTMNVPPSKAIHIDHENRIQQILRVFDLDPN
YGPCMGLSRLERWQRAKDLQLHPPQEIHDILITRQGGNEYKENVFNAHGL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaaagctcgaaccagaaatcactctcgttcaaggctcagtcgaagcctaaa
tctacctactcggcctctgccaaggaccagctcaagaccaaagcgaacctcaagacttca
acacctaacaaaccgctcacatcatcactcgtgcgaaagccttcacctacttgcacagca
acatccaaacaagattcggagtatgcaaaccgaaaagatctcgatgtggacgatgaacga
tgggatggtgtttggcgcacgacgaaaaagacgatgaacgttccaccgtctaaagcgatt
catatcgatcacgaaaatcgaattcagcagatcttgagggttttcgatctggatcctaac
tacggaccttgcatgggcttgtcccgattggaacgctggcagagggccaaggacctacag
ctgcatccaccacaggagatccacgatatcttgattacaaggcagggtggaaacgagtac
aaagaaaatgtgttcaatgctcatggcctctga

DBGET integrated database retrieval system