KEGG   Ustilago maydis: UM00543.1Help
Entry
UM00543.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
uma  Ustilago maydis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    UM00543.1
Enzymes [BR:uma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     UM00543.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1353 aa AA seqDB search
MEDLSADDDILSDILLDNLEFEPAISTHKMNPHYRGHRFDRNAVSLIVRKRVVVERDITA
AIEDLTKLGIIHKYLSNKTQRQISSFHAHARRYLESYLPESGVEFALTTRYKRVMMEKAG
TPPGADAEASTSAVKLEDTPSSPAKDALEDRGKARTKARSSLDRAATSIGAAPAASEKAD
LCVLAMRTFKPGELIHFCKGGLKDLTKSEDDALREEATASREKRKDSEYKGVLGPGRDFS
VIRSARKGCSQLLLGPARFVNHDCNPNTEFYRMGATMVFKVIRPIHRNEEITTFYGENYF
EWGNAECMCATCESRGTGAFSDPSVPPPIEPSELSDRVEVKIEEAASTGTPAESNGRRQS
RRSSRQAGASSALPSPSPTPSLTPSLNTALGDDAAKDKKSRRDYLADLKLAEHGPSDDRS
DPWAEGAGPKCRCLTCGATFWAPEKWWTPDECSRCERHYKIFKADWPGRVPTEGSLQRKA
GVKRKTSSEMISDHLASTITPARNGKERSLTPTELKTNATPKVQKRSRSSKSVADTTTSG
ASAKTPPAKSTIATATAKVVKVTATTTSAPASSGKPPVRPAKANEAKSRKQERQDEAAIA
QTLATPPAKAAPKSESTYNLDSDGSDLTPEPESEQGDTQKPEEEEEDEDHGPRPVSAAGR
SQPVNTDRSSSSSSSPGPPGPKMLGKNAKTDVLAQYWGAAEGDRRARRKAPVNPGPTLLA
ARRSSQDVTHKPTERRSSFREASTDEQGVPKLKRRLVAESASDAEDASPHPPTAPRSNPA
AAAYKHRKTSSMNDASFVQIRAKSEMRPSPDRLTPSFTTSAVSPAQPAKLAASASALPPK
ASAGNLPGLATSGVERTSESNLALFWSAGVGGTRNRRQAQREPQTVLVPTVPSKRSRNAS
ESSRSRTPEVKKPRGAIRPNTGNGDDEGSGRDQSVRSRSLAASDDGSLETSRENSDVDDD
HPQSGDAPVRPYMFSAISKASQSNGAVDVGGVLELKGPLLPSAPLFRPPGLIRPDLAAAA
ARSNSPLAGPPRGTPGQPMRKNLRWGSGKSSMSRALGPNGSPLGRPPASVNGSPVSVSAQ
RSAEDVKPQLHRTTGSPQMRPGPLALANQLQPSPNRSDASALERSVDQAGAGREPSQVQA
AAALAQTVLAQPLEPVKAEAVTASLSSVATPDTEATSRIAVQAPTLVNDLATDATVSDKA
ASTTTVDAHAVLAAPAAAVDQKSTVNVAAHDVCSNLDAPESQHRRTSARARKPPEMAAGQ
IQYKGSLVKLAAQRAKGAQSRLSPRTLSPDVALSSANSHTSTRPPPDAAPDTLHTLHTDK
LDNSISSSVHIAPDKHALVATSATATPMDVDKF
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggaggacctctccgcagacgatgatatcctctccgatatcttgctcgacaacctcgaa
ttcgagcctgccatctccacacacaagatgaatccacactacagaggtcatcgcttcgat
cgcaatgccgtcagtctcatcgtcaggaagcgtgtcgttgtcgagcgcgacatcacagcc
gccatcgaggatctcaccaaactcggcatcatccacaaatatctcagtaataaaacccag
cgtcagatctccagcttccacgctcacgcacgacgttatcttgaaagctacctcccagag
agtggcgtcgaattcgctctcaccacacgctataaacgtgtcatgatggaaaaggccggc
acaccgcctggcgcagacgcagaggcttccacttccgcagtcaagcttgaagacacgccc
tcttctcccgctaaggacgccctcgaagacagaggcaaggctcgcacaaaagccaggtcg
tcgctcgatcgtgccgccactagcatcggcgctgcaccagccgcttccgaaaaggcagat
ctttgcgtcctcgccatgcgtaccttcaaacccggcgagctcatccacttttgcaagggt
ggcttaaaagacctcacaaagagcgaagatgacgcgctacgcgaggaagccaccgcctcg
cgcgagaaacgcaaagactccgagtacaaaggcgtacttggcccaggacgcgacttctct
gtcatcagatccgccagaaagggctgcagccagctgctgctcggcccagccagattcgtc
aatcacgattgcaatccaaacaccgaattctaccgcatgggcgcaaccatggtcttcaaa
gtcatccggcccatccaccgtaacgaggaaatcaccactttttacggcgaaaactacttt
gaatggggcaacgcagaatgcatgtgcgcaacttgcgagtcccgcggcacaggcgccttt
tcggatccatcagtgcctccacccatcgagcccagcgagctttccgaccgtgtcgaggtc
aagatagaggaagctgcatccacaggcacaccagccgagtccaacggtcggcgccaatca
cgccgttcaagtcggcaagccggtgcatcatcagctcttccatcgccgtctccaacacca
tccttgacaccctccctcaacacagctctcggcgacgatgctgccaaggacaaaaagtcc
agacgcgattacctcgcagatctcaaattagcagagcatggtccttcggacgaccgttcg
gatccatgggcagaaggagccggtcccaagtgccggtgtctcacgtgcggtgccacattc
tgggccccagagaagtggtggactccagacgagtgctcacgctgcgagcgtcactacaag
atcttcaaagccgactggccaggtcgcgttcccaccgagggctccctgcagaggaaagct
ggtgtcaagcgaaagactagctcggagatgatctccgaccatctcgccagcaccattacg
cctgcgcgaaacggcaaagagcgctccttgaccccaacagagctcaagactaacgccaca
ccgaaagtccagaagagatcgcggtccagtaaatctgtcgctgatactaccacctctggc
gcaagcgccaagacgccgcccgcaaaatctacaattgccactgcaaccgccaaggttgtc
aaagtcacagccacaaccacatcagcgcctgcaagttctggaaagcctcctgttcgtcct
gccaaagctaacgaagcaaagagcagaaaacaagagcggcaagacgaagcggcgatcgct
cagaccctcgctactccacccgctaaagcggcacccaagtcggaaagcacctacaacctt
gattctgacggttcggatctcacaccggagcccgaatccgaacagggtgatactcaaaag
ccagaagaggaggaagaagacgaagaccacggacctcgacccgtctctgctgccggtcga
tcgcagcctgtgaacacggatcgttcgtcgtcgtccagttccagtcccggaccacccggt
cccaagatgctcggcaaaaacgcaaagaccgacgtcttggctcagtactggggagccgcc
gagggtgaccgccgtgcacgcagaaaagcgcctgtcaatcccggtccgaccttgctggcc
gcccggcgctcttctcaagatgttacccacaagcccacagagcgtcgctcaagcttccgt
gaggcgagcaccgatgagcaaggcgttccgaagctcaagcgacggctcgtcgcggaatct
gcgtctgacgccgaagacgcatcaccgcatcccccaactgctcctcgctcaaatcccgcg
gcagcagcttacaagcaccgcaaaacgtcgagcatgaacgacgcttcgtttgtgcagata
cgagccaaatcagagatgcgaccatcgccagatcgacttacgccctccttcactaccagc
gcggtctcaccagcccaacccgccaaactagctgcatcagcgtcagcgctgccaccaaaa
gcctcggcgggcaacctgcccggtttggccacctcgggggttgagcgtacgtccgagtcc
aatctagctcttttctggtcagcaggggtaggaggtacgaggaaccgacgtcaggcgcag
agagagccccaaacggtgcttgtcccgacggttccgtcaaagcgatcgagaaatgcgtcc
gagtcgagtcgaagccgcacgcccgaagtgaagaagccacgtggcgcaatcagacctaac
accggcaatggagatgacgaaggcagcggtagggaccaaagcgtgcgatctcgctctttg
gccgcgtcggacgatggatcattggagacgagccgggagaacagcgatgttgacgacgac
catccacaaagtggcgatgcgcctgtcaggccctacatgttttcagcaatcagcaaagcg
tcgcagtcgaatggagctgtcgatgttggaggcgtgttggagttgaaaggaccgctcttg
ccatctgcaccgctctttcgaccacctggtttgatccggcccgacctcgcggcagcagcg
gcgcgttccaactcaccactcgctggacctccacgtggtacgcctgggcagccgatgcgc
aagaaccttcgctggggcagcggcaagtcttcaatgagccgtgcgctgggcccgaatgga
agccctctgggacgtccccctgccagtgttaacggaagtcctgtaagcgtgtcagcgcag
cgatctgccgaggatgtcaaacctcagctgcatcgtacgaccggctcgcctcagatgaga
ccgggaccactcgcacttgctaaccagctgcagccatccccaaaccgctcagacgcatca
gcgctcgagcgcagcgttgaccaagctggtgcaggccgcgagccgagtcaggtgcaggcg
gctgctgcgcttgcgcaaacggtattggctcagccgcttgagccggtgaaagcggaggcg
gtgacggcgagtttgtcgagcgttgcaacgccagacacggaggcgacgtcgaggattgcg
gttcaagcacccactctggtgaatgacttggcgaccgacgcgacagttagcgacaaggcg
gcgtcaacgacaactgttgatgcgcacgccgtacttgctgcgcctgcggcagcagtcgat
caaaagtcaacggtcaatgtggcggctcacgacgtatgctcgaacctggacgcgcccgag
tctcaacaccggcgcacatcagcgcgtgcacgcaaacctcccgaaatggctgctggtcag
atccaatacaagggcagtctggttaaactcgcggctcagagggcgaaaggcgcacagtct
cggctctcgcctcgcacgctctcgccggacgtcgcgctttcgtctgcgaactctcacact
tcaactcgaccgcctccagacgctgctccggacacgctccacacgctacatacggataag
ctcgacaactccattagcagctcggtgcacatcgcgccagataagcacgctctcgtcgcg
acctctgctacagcgacgccgatggacgttgacaaattttaa

DBGET integrated database retrieval system