KEGG   Ustilago maydis: UM00646.1Help
Entry
UM00646.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
uma  Ustilago maydis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UM00646.1
Enzymes [BR:uma01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     UM00646.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 324 aa AA seqDB search
MVLIEQVVLVASILITFGTCLAATKYAARLFPHFEPLQFYDEATNPMELNIVLAFVVGLI
GSVVVLLYFDSQKIKPVLNPTQWQQYRLMEKQKLSDNTALYRFKLPRSNNILGLPIGQHI
SVQANMGGKTVVRSYTPTSSDDDHGFFDLVVKSYEQGNVSKYIGSMKIGDLLSVKGPKGQ
MRYAPGLSRHIGMIAGGTGLTPCLQIIRAALKNPADKTQIDFIYANVKETDILLKDELDE
LALKHKDQFRISYFLNEAPEGWKGGVGFVTKEALEKNLPKPANDIKVLMCGPPPMIKAMT
GHLEALGYEKPRTVSKLEDQVFCF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgatcgagcaagtcgttctggttgcttccatcttgatcactttcggtacttgt
cttgccgcaaccaagtacgccgctaggcttttcccccacttcgaaccgcttcaattctac
gacgaggcaaccaacccaatggagctcaacattgttctcgcttttgtggtgggcctgatc
ggctcagtggtagttttgctctactttgactcgcagaagatcaagcccgtgctcaacccc
acccaatggcagcagtatcgtctcatggagaagcagaagctctccgacaacactgccctc
taccgcttcaagcttccccgttcgaacaacatcctcggcctgcccatcggacagcacatt
tccgtacaggcgaacatgggcggcaagaccgttgttcgttcgtacacgcccacttcctcg
gacgatgaccatggattctttgatctcgttgtcaagtcgtacgagcagggcaatgtgtcc
aagtacattggctccatgaagatcggcgatctcctctcggtcaagggccccaaaggtcag
atgcgttacgctcccggtctctcgcgccacattggcatgatcgccggtggtaccggtctc
accccttgcttgcagatcatccgtgccgccctcaagaaccccgccgacaagactcagatt
gactttatctacgctaacgtcaaggagactgacatcttgctcaaggacgaactcgatgag
ctggcccttaagcacaaggaccagttccgcatctcctacttcctcaatgaggcccctgaa
ggctggaagggcggcgttggcttcgtcaccaaggaggctttggagaaaaacctgcctaaa
cccgcaaatgacatcaaggtcctcatgtgtggtccgccgcccatgatcaaggccatgacc
ggacacctcgaggctcttggatacgaaaagcctcgcaccgtcagcaagctcgaggatcag
gtcttctgcttctaa

DBGET integrated database retrieval system