KEGG   Ustilago maydis: UM00655.1Help
Entry
UM00655.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
uma  Ustilago maydis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:uma00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 598 aa AA seqDB search
MRSVATQSLGVLVALTHLVLGIDAQTTSQQVYEPPAASSGAVSQQSNLTNGVNPQYADLL
GNALWFYEAQRSGALPADNRVPWRNSSCENDGSLNNTDLSGGYYDAGDYIKATYPFCWTV
TSIAWSALSFGSAYARSSQDAYLDSTLRWGLDWLSKAHSDQNTLWVLVGNPTIDDQYWGG
DRNIPDPRPSYSVTRQNPGTDAFASCAAAFAASAYLYSGRSASLPTSAGGAQLGGVPSIH
NQTYSEALLRHAEGLWDLAINSSPKQVYSMAQPVAGQSYPSSDYEDDLAFAGLWMALAKA
DASYANQGLAFYPNGSNAFASINAALNWDRKVAALPVLATQLAQHNASMNLDMSRFQNDA
ESYFDRLTDGKMQYVSQTRGGLYWWKGDSDAASLNPALNAAFIADLYSGFATTSAKTSAY
RSLADSQVDYLLGDNNYNGPYVVGQHPNSPQNPHSAMASGGNDITNVNNSPPQELHVLYG
AVVGGPDKQDRFFDIRDDWPQTEIALDYNAPLVAAAVSRIARNVTKDPPYTTSSGSANVA
QGRPTDAAYPAKSGGLSQGAKIAIAVIVVVVVLAAIGGLCWWQRQRIRWYFRQKKMGL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgtcgctacacagtcgttgggcgtgctcgtggcactgacgcatcttgtgcta
ggcatcgacgcccaaactacatcacaacaggtctacgaaccgcctgcggcatctagcgga
gcagtttcgcagcagtctaatctcaccaatggtgtcaatcctcagtatgccgaccttctt
ggcaacgcgctttggttctacgaggcgcaacgaagcggtgctctccccgccgacaatcgc
gtgccttggcgcaacagcagctgcgagaacgacggctcgctcaacaatactgacttgtct
ggtggctactatgatgcaggtgactatatcaaggccacctatccattctgctggaccgtg
acgtccatcgcctggagtgcgctgagcttcggttcggcgtacgcaaggagctcgcaggac
gcatatctcgactcaacacttcgatggggccttgactggctttcaaaggcacattcggat
caaaacaccttatgggtcctcgtcggcaaccctaccatcgacgaccagtattggggtgga
gatcgcaacattccagatccgcgaccctcgtacagcgtgacacgacagaacccaggaacc
gatgcctttgcctcgtgtgctgccgcctttgccgcatcggcctacctgtacagcggtcga
agcgcctcgcttccaaccagcgcaggcggtgcccagctcggaggggtacccagcatccac
aaccaaacctactcggaagccctgctgcgccacgccgaaggactctgggacctcgccatc
aacagctcgccaaagcaggtctactcgatggcacaacccgtagctggccaaagctacccg
tcgagcgactacgaggatgatctcgcttttgccggtctgtggatggcattggccaaagcc
gatgctagctacgccaaccagggtctcgccttttatcccaatggtagcaatgcctttgca
agcatcaacgctgcgctcaactgggatcgcaaagtggccgcccttcctgtccttgcgacc
cagctggctcagcacaatgcctcgatgaatctcgatatgtcgcgcttccagaacgacgcc
gagtcgtactttgaccgcctgacggacggcaagatgcagtacgtcagccagacgagaggt
ggtctttactggtggaagggcgacagcgatgctgcaagtctcaatcctgccctcaacgct
gcctttatcgctgatctttactcgggcttcgctacgacctcggccaagacgagcgcctat
cgatcgctcgccgactcacaagtcgactatcttcttggagacaacaactacaacgggcct
tacgtggtcggacagcatcccaacagccctcaaaaccctcactcggccatggcatctggc
ggaaatgatatcaccaacgtcaacaacagcccgccccaagaattacatgtgctgtatggt
gctgtggttggaggacccgacaagcaggatcgtttcttcgatattcgagacgactggcct
cagacagagattgcactcgactacaacgctccactggtagctgcagccgtatcgcgcatc
gctagaaacgtgacgaaagatccgccttataccacatccagcgggagtgccaacgtagcc
caggggcgacccaccgatgcagcataccccgctaagagcggcggactcagccaaggcgca
aaaattgcgattgctgtgatcgtcgttgttgttgtgcttgccgcgattggcggtctgtgt
tggtggcagcgccaacgtatccggtggtactttcgccagaagaagatgggtctatag

DBGET integrated database retrieval system