KEGG   Ustilago maydis: UM00655.1Help
Entry
UM00655.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
uma  Ustilago maydis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UM00655.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     UM00655.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 598 aa AA seqDB search
MRSVATQSLGVLVALTHLVLGIDAQTTSQQVYEPPAASSGAVSQQSNLTNGVNPQYADLL
GNALWFYEAQRSGALPADNRVPWRNSSCENDGSLNNTDLSGGYYDAGDYIKATYPFCWTV
TSIAWSALSFGSAYARSSQDAYLDSTLRWGLDWLSKAHSDQNTLWVLVGNPTIDDQYWGG
DRNIPDPRPSYSVTRQNPGTDAFASCAAAFAASAYLYSGRSASLPTSAGGAQLGGVPSIH
NQTYSEALLRHAEGLWDLAINSSPKQVYSMAQPVAGQSYPSSDYEDDLAFAGLWMALAKA
DASYANQGLAFYPNGSNAFASINAALNWDRKVAALPVLATQLAQHNASMNLDMSRFQNDA
ESYFDRLTDGKMQYVSQTRGGLYWWKGDSDAASLNPALNAAFIADLYSGFATTSAKTSAY
RSLADSQVDYLLGDNNYNGPYVVGQHPNSPQNPHSAMASGGNDITNVNNSPPQELHVLYG
AVVGGPDKQDRFFDIRDDWPQTEIALDYNAPLVAAAVSRIARNVTKDPPYTTSSGSANVA
QGRPTDAAYPAKSGGLSQGAKIAIAVIVVVVVLAAIGGLCWWQRQRIRWYFRQKKMGL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgtcgctacacagtcgttgggcgtgctcgtggcactgacgcatcttgtgcta
ggcatcgacgcccaaactacatcacaacaggtctacgaaccgcctgcggcatctagcgga
gcagtttcgcagcagtctaatctcaccaatggtgtcaatcctcagtatgccgaccttctt
ggcaacgcgctttggttctacgaggcgcaacgaagcggtgctctccccgccgacaatcgc
gtgccttggcgcaacagcagctgcgagaacgacggctcgctcaacaatactgacttgtct
ggtggctactatgatgcaggtgactatatcaaggccacctatccattctgctggaccgtg
acgtccatcgcctggagtgcgctgagcttcggttcggcgtacgcaaggagctcgcaggac
gcatatctcgactcaacacttcgatggggccttgactggctttcaaaggcacattcggat
caaaacaccttatgggtcctcgtcggcaaccctaccatcgacgaccagtattggggtgga
gatcgcaacattccagatccgcgaccctcgtacagcgtgacacgacagaacccaggaacc
gatgcctttgcctcgtgtgctgccgcctttgccgcatcggcctacctgtacagcggtcga
agcgcctcgcttccaaccagcgcaggcggtgcccagctcggaggggtacccagcatccac
aaccaaacctactcggaagccctgctgcgccacgccgaaggactctgggacctcgccatc
aacagctcgccaaagcaggtctactcgatggcacaacccgtagctggccaaagctacccg
tcgagcgactacgaggatgatctcgcttttgccggtctgtggatggcattggccaaagcc
gatgctagctacgccaaccagggtctcgccttttatcccaatggtagcaatgcctttgca
agcatcaacgctgcgctcaactgggatcgcaaagtggccgcccttcctgtccttgcgacc
cagctggctcagcacaatgcctcgatgaatctcgatatgtcgcgcttccagaacgacgcc
gagtcgtactttgaccgcctgacggacggcaagatgcagtacgtcagccagacgagaggt
ggtctttactggtggaagggcgacagcgatgctgcaagtctcaatcctgccctcaacgct
gcctttatcgctgatctttactcgggcttcgctacgacctcggccaagacgagcgcctat
cgatcgctcgccgactcacaagtcgactatcttcttggagacaacaactacaacgggcct
tacgtggtcggacagcatcccaacagccctcaaaaccctcactcggccatggcatctggc
ggaaatgatatcaccaacgtcaacaacagcccgccccaagaattacatgtgctgtatggt
gctgtggttggaggacccgacaagcaggatcgtttcttcgatattcgagacgactggcct
cagacagagattgcactcgactacaacgctccactggtagctgcagccgtatcgcgcatc
gctagaaacgtgacgaaagatccgccttataccacatccagcgggagtgccaacgtagcc
caggggcgacccaccgatgcagcataccccgctaagagcggcggactcagccaaggcgca
aaaattgcgattgctgtgatcgtcgttgttgttgtgcttgccgcgattggcggtctgtgt
tggtggcagcgccaacgtatccggtggtactttcgccagaagaagatgggtctatag

DBGET integrated database retrieval system