KEGG   Ustilago maydis: UM00695.1Help
Entry
UM00695.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
uma  Ustilago maydis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UM00695.1
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    UM00695.1
   00603 Glycosphingolipid biosynthesis - globo series
    UM00695.1
   00604 Glycosphingolipid biosynthesis - ganglio series
    UM00695.1
   00511 Other glycan degradation
    UM00695.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     UM00695.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 688 aa AA seqDB search
MWCARTATLLASACLVGAFSANALWPHPTTYKSGKDDAFVRLSGGLRFQLVDGTDQSRVP
ADLSQAVTAAATLANTIDLWELAPDRGESHRDSVNKASLIASVQIKVLELMPDTTPCPCF
TKAEEESDAASRLRALQQPFQGRRSAVDAPQMQFKEAVGNNATDVWSNKCSIANHAIKEL
SYNSSSKSLNLETDKSAPADLGVLDAEMYRLSIPSNGASIELTSYTSLGALRGLQTLLQL
IYALPPQQGGKAQSQRYIRNVPITIEDRPAYPYRGLMLDTARNWFDIATIHKLIDTMSFV
KLNQLHWHATDTQSWPLAFNDEDGSDLSILSEKGSYGWFKRDNGEVVRMVYTEDDIKGIV
DYAAAKGVNVIIETDMPAHMLSGVEAVGAGSLMACPDQLDWIAVSAEPPSGQLRLVSNSS
ALDTTDVKTFKIPEPISKFVTSLLRKTSSLSKSYYVSSGGDEPNFHCWNLSSEAAMEPYL
QPFMSLVTNVTSAAGKRGLVWEEMAVKFPTVAKTLAKGSLVEIWNDPNNSAIALKNNPDV
SIVLAPYTFAYLDCGGSNFLGNYTGNNWCPYVSWQQSYSFDPAVIVANATATLKADAKQT
REKFVGGESAVWTEQIDATNLDSKVWPRAAAGAEIWWTGETVDGKKRDKVEALARMLDLR
WRLVALGVKAEPLQPQWCATRPGMCNMH
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcgctcgcacggccactttgttggcttcggcctgcctcgttggcgctttctct
gcaaacgccctttggcctcacccaaccacctacaagtcaggcaaagacgacgcttttgtt
cgcctctctggcggcctgcgcttccagcttgttgatggtaccgaccagtcgcgcgtcccc
gccgaccttagccaggctgtcacggctgctgctacgttggccaacacgatcgatctgtgg
gagctcgcccctgaccgaggcgagagtcaccgtgacagcgtcaacaaggcttccctgatt
gccagcgtacagatcaaggtgctggaattgatgcctgacacaactccttgcccttgtttc
accaaggcagaagaggagagtgacgcagcttctcggctcagagcgttgcagcagcccttc
cagggcagacgctcggcagtcgatgcgcctcagatgcaattcaaggaagcagttggtaac
aacgctacagacgtctggagcaacaagtgcagtatcgcaaatcacgccatcaaggagttg
agctacaacagctcgtcaaagtcgctcaacttggagacggacaagagcgcgcctgccgat
ctgggtgtcctcgatgccgagatgtatcgactctcgattccgtccaacggtgcctcgatc
gagctcacctcttacacgtctctcggtgctcttcgcggactgcagactttgctgcagctc
atctatgctctccctcctcagcagggagggaaagctcagagccagcgttacattcgcaac
gtgcccatcacaatcgaagatcgcccagcttacccttaccgaggtctgatgctcgacact
gcgcgcaattggttcgacattgctaccattcacaagctcatcgacaccatgtcttttgtc
aagctcaaccagcttcattggcacgctaccgatacgcagtcgtggcctttggcatttaac
gacgaggatggctctgatttgagcatcctgtccgagaagggctcgtacggctggttcaag
agagacaatggagaggtggtgaggatggtttacaccgaagatgacatcaagggcatcgtc
gattacgccgccgcaaagggtgtcaatgtcattatcgagacggatatgcccgcacacatg
ctttcgggtgttgaagccgtcggcgctggaagcctgatggcatgccccgatcagctcgac
tggatcgcagtttctgctgaacctccttcgggtcagcttcgactggtatccaacagctct
gctcttgacaccaccgatgtcaagacgttcaagatcccagagcccatcagcaaattcgtc
acctcgcttctgcgcaagacttcttccctttccaagtcgtactacgtctcgtcgggcgga
gacgagcccaacttccactgctggaatttgtcaagcgaagctgccatggaaccgtacctg
caacccttcatgtctctcgttaccaacgtcacctcggccgccggcaagcgtgggctggtg
tgggaagaaatggcggtcaagttccccacggtcgccaagacgctggccaaggggtcgttg
gtcgaaatctggaatgatcccaacaactcggccatcgcgctgaaaaacaaccccgacgtc
agcatcgttcttgctccttacacgttcgcttacctcgactgcggcggatccaacttcctc
ggcaactacacaggcaacaactggtgtccatatgtctcgtggcagcagagctactctttc
gacccggctgtcattgtggctaatgccacggctacgctgaaggcggatgccaaacagact
cgagagaaattcgtgggtggagaatccgctgtttggaccgagcagatcgacgcgaccaat
ctggattccaaagtctggcctagagccgctgctggtgcagagatctggtggaccggcgag
acggtggatggcaagaagagggacaaggttgaagcgctggctaggatgttggacctgaga
tggaggttggtcgctttgggtgtgaaggccgaacctttgcagccgcagtggtgtgccact
cgtcctggcatgtgcaacatgcattga

DBGET integrated database retrieval system