KEGG   Ustilago maydis: UM00801.1Help
Entry
UM00801.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
uma  Ustilago maydis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1919 aa AA seqDB search
MAHLAAHIEQPEARRTAFTSSQPPHPYMIDGNGRTASASRASHQQQYSFPQMSDPGTLVL
STSTNTGGQPRNNNGSLLNSTSTLEADTDAQQLTTEPEEEDDASTASGKRHGALLVEEAN
EWMLQHSFFHWGLKRHITHGNPKSRDERDLPDWRMRERLRTVTAALVMCLNIGVDPPDVS
KTNPCSKLICWMDPSSLEVSKALPAIGRNLQAQFETLSTKTRYKQYLDPIVEETRRFCTT
LRRAAKDERVLFYYNGYGVPKPTPGGEIWVFNKAYTQYIPVTLYDLLTWLGSPCIFVWDA
SSAGNVVLNFKRLQERKAEEEATRSNRDREGHNRSGDRDRSKPHADASSSTGKSSAQSSS
TEEPHFPLRESIHLAACGPDEVLPMNPDLPADLFTCCLTSPIEISLRWFVLQNPLPSKLN
VDMVMNIPGRLQDRRTPLGELNWIFTAITDTIAWTVLPRTIFRRLFRDDLMVAALLRNFL
LAERIMRFYHCTPMSHPKLPPTHNHPLWDSWDLAVDQCLAQLPTLLAKERAQAEAADGGP
PVPPHLASFEYRHSTFFSEQLKAFEVWLQQGGVSRKGRRRRVNAAITPHGNPFAGLSSAA
TGADPEAFDDDGDASPVREPPDQLPIVLQVLLSQAHRLRALILLSQFLDLGPWAVNMALS
IGIFPYVLKLLQSPAADLKPVLIYIWARILAVDRSCQNDLLRDNGFIYFAGVLSPFQNSN
AGQNAGANGPSIPIPNVSEHQAMCAFILAVFCQDFPAGQAACLETDVMHSCLEHLEDDDF
LLRQWSALCLAQLWDDNEAGKARAISLDAHGKLCCMLGDVSPEVRAAVLHALGTLLGASG
SSQDQVDVVSYVTGEPVPVSNANRPASARRFCPGTGAVTGLPPAKQRGLEIGIAIALLTT
KGDCSPLVRKELVIALSPVVAEYKGFFVLAAYLYYSREGSLQNPPSQQDRTSAAGRAKTA
QSSGDSDRRGSLASLGQDNSKKSVSGPTTATLAAEEALLARLASKLLIEEEIEEEDIANI
PAFMTIFVALLDLSVDSNPEVANLACTVVDFVIALLLESDVSNAGESVLRGLGAQGTLSR
FTTPTSTDAALEGYFPLTPRSTGTTPGSTDEMSTSQIAAMNGAHVPPSGFGTGGSGPARP
GHLVRAQSQAAPKRTSTLAQAVKTLATLGYSRPVSPVGSDHDTLGRPLYGEAGPSGIPPP
GPAVLAPRRSPGTKATAAQYSSPYLPKSGAGGPTTPSHEAPSTLSMPSSPLNPAAKLGNR
SQSAESLSIINGSADRRKLSASSSGLIQAQQRPNGNGHGNGSLLDNSTEQASSGMYDQQR
FYGDELDKDPHVAVDDHVKVGDTLAGLIAMDMFRFRSRFTGSADGSTQNTPASSPAVSRA
NRWGFMPTPGSSGVSTPSGSVGSGGASNELRETLPLKSRLFAWCSEYYIEPQMKQAESEE
PGSIKYNVQHWKKQRNSRLTEHSLEIADVAAQSAWSEHGGYIRNGAVPYLMLFHQYENHL
VTASDQDTVAVWDWEEKRLLSRFANGNPSRTNITSTLFINEDSDAMLLVGSAEGNVRIYR
HYDSPAHTAGFRGPKLASSFQALPDLVRSKRPSGLVVDWLQGSGHLLAGGDSRVIRVWDA
HRELCVVDIPTRASSCVTSISSESDFGHLFVAGFGDGTVGVYDRRNPPEASLVRLWEEHQ
TWVQNVHLQKRGSRELVTASVDGQVRLWDMRVRSSIAKLSLGGKLGGKLSCIAVHEQIPL
FAASSAPKPLRPTASAQTVLLTHLETLSTLGKPIVRSFAPMGSTQHLGNSTLLYPPEAVN
SGVHHHHYLHHLHHPGETHHGGMGGSGFLSMQHSAFSAGNGGAGSGLVAGISGTSSGMHH
GPHLNPANPLHALMPPATEIAPSGFTPAMGSMAFHPHLPILAFGGPDTLIELREWPDSS
NT seq 5760 nt NT seq  +upstreamnt  +downstreamnt
atggcacaccttgctgctcacattgagcaacccgaggcgcgccgtactgccttcacctca
tcccagccccctcatccctacatgatagatggtaacggccgtacggcttccgcctcgcgc
gcatcacatcagcagcagtattcattcccacaaatgtccgacccaggtacgctcgttctc
agcaccagcaccaacaccggcggccaacctcgtaacaacaacgggtccttgctcaactct
acctccacgctcgaggctgataccgacgctcagcaactcaccaccgagcctgaagaggaa
gacgatgcatcgacagcgagcggcaaacgtcatggtgcgctcctcgtcgaggaggccaat
gagtggatgctgcagcactccttcttccactggggcctgaaacgccacatcacccacggc
aaccccaaatccagggacgagagagatcttccagattggcggatgcgcgaacgtctacga
accgtcacggctgctctcgtcatgtgcctcaacattggtgtcgatcctcctgatgtgtcc
aaaaccaatccctgctccaagcttatctgctggatggaccccagctcactcgaagtatcc
aaagcactgcccgccatcggtcgcaatctgcaagcccagttcgagacgctcagcaccaag
actcgttacaagcagtacctcgatcctattgttgaagaaacacgtcgcttctgcacaaca
ttgcgaagggcagccaaggacgagcgcgtgctcttctattacaatggatatggtgtgccc
aagccaacaccgggcggcgaaatttgggtgttcaacaaggcctatacgcaatacatcccc
gttaccctttacgacctgctcacgtggctggggagtccttgcatctttgtatgggacgcc
agctcggccggcaacgtcgtactcaacttcaagcgtctacaagagcgaaaggcggaagag
gaggcaactcggtccaatcgagacagggaaggtcataaccgctccggcgatcgtgaccgt
tccaaaccacatgctgacgcatcctcttcgacaggaaagtccagtgcacagtcttcgtcg
acggaagagccacatttccctttgcgcgagtctatccacctcgctgcttgcggtccagat
gaggtgcttcccatgaatccagatcttcccgccgatctcttcacttgctgtctcacttca
cccatcgaaatctctctgcgctggtttgtgctccaaaatcctctcccgtccaagctcaat
gtcgacatggtcatgaacattcccggtcgccttcaagatagaagaactcctctcggcgaa
cttaactggatcttcaccgccatcaccgacaccatcgcatggaccgtcctaccacgcacc
attttccgccgtcttttccgagacgacctcatggtagcagcgcttctccgcaacttctta
cttgccgaacgtatcatgcgcttctatcactgcacgcctatgagccatcctaagcttccg
ccgactcataatcatccactttgggacagctgggatctcgccgttgaccagtgcctggca
caattgcccacgttgcttgcaaaggagcgagcacaggctgaagctgctgacggcggacca
cctgttcccccccaccttgcgtcgtttgagtatcgtcacagcacctttttcagcgagcag
ctgaaagctttcgaggtctggctgcagcagggcggcgttagtcgaaaaggaaggaggcgt
cgtgtaaacgctgcgatcactccgcatggcaacccttttgcaggcttgtcatccgcagcg
accggcgccgatccagaagcattcgacgatgacggtgatgcaagcccagttcgcgaaccg
cctgatcagctgccgatcgtactgcaagtgctgctgtcccaggcacatcgcctacgtgct
ctcatcctgctcagccaatttctcgacctcgggccgtgggcagtcaacatggcgctcagc
atcggtatcttcccctacgtactcaagcttttgcaaagtccggctgctgatttaaagcct
gttttgatctacatttgggctcgaattctggcggtggaccggagctgccagaatgattta
ttgcgagacaatggcttcatctactttgcaggtgttctaagtccattccagaacagcaat
gcgggtcagaacgctggtgccaacggaccctcgatccctatccccaacgtctcggagcac
caagccatgtgtgcattcattcttgccgtcttctgtcaagacttccccgccgggcaggct
gcgtgtctcgagacagacgtcatgcactcatgccttgagcatctcgaggacgacgacttt
ttgttgcggcagtggagtgcactttgcctggcccagctttgggatgacaacgaagcgggc
aaggcacgcgccatctcgctagacgcgcacggaaaactctgctgtatgcttggcgatgtt
tcgcccgaggtgcgggctgccgttctccatgctctcggcactctgctcggtgccagtgga
tctagccaagaccaagtcgacgttgtctcgtatgtcacgggcgagccagtgcctgtctcc
aatgctaaccggcccgcttcggcgagacgcttctgccctggcactggcgctgttacaggt
ctgccgccagctaaacagcgaggtctcgaaatcggcattgccattgctttgcttacgacc
aaaggagactgtagcccgctggttcgaaaggaactggttatcgcactcagccctgtggtg
gctgaatacaagggattttttgtcctcgcggcgtacctgtactactcgagagagggcagc
ttgcagaatccaccttcacaacaggatcggacgtcagcggcaggccgcgctaagacagca
caatcgtctggcgacagtgatcgacgcgggtcattggcatcgttgggtcaagacaactcc
aaaaagagcgtctcaggaccgacgacagctacacttgccgctgaggaggccttgctcgcg
cgtctcgcatccaaacttctgatcgaggaagaaattgaggaggaagacattgccaacatt
ccagcctttatgaccatcttcgtcgcgctgcttgatctcagcgttgactcgaatccggag
gtggcgaatctggcatgcacggtggtcgattttgtgatcgctcttttgctcgaaagcgat
gtgtcgaatgccggcgagagcgtcctacgaggtcttggcgctcaaggaactctttcgcgc
ttcactacgcccaccagcactgacgctgcattagagggatattttccactgacaccccgc
tctactggaacgacaccagggtcgaccgacgagatgtcaacgtcacagattgcagccatg
aatggagcacatgtacccccctctggctttggcacgggtggttctgggcctgcccgtccg
ggccatttggtgcgtgcacagtctcaagcagcacccaagcgtacttcgacgcttgcacaa
gcggtcaagacgctagctaccttgggttattcgcgaccagtgtcaccggtcgggtcggat
cacgacaccttgggccgacccttgtacggcgaagcagggccatcaggcattccgccccct
ggtccagctgtgctcgcaccgcgtcgcagtccaggcaccaaggcaaccgcggcccagtac
agctctccctatcttccaaagagtggtgcaggtggtccgacaactccttcacacgaagcg
ccgtccacgctatcgatgccctcgtcgccgctcaacccggccgccaagcttggcaaccgc
tcgcagagtgcagaaagtctgtctattatcaacggaagcgcggatcgcagaaagctgtcg
gcaagcagcagtggcttgattcaagctcagcagcgccccaacggcaacggccatgggaac
ggcagcttgctggacaacagcactgaacaggccagcagtggtatgtacgaccaacaacgc
ttctatggcgatgagctggataaggatccacatgtagctgttgatgaccatgtcaaggtg
ggagacacactcgctggactcatcgcaatggacatgttccgcttccgctcgcgctttacg
ggcagcgccgacggctcgacgcaaaacacgccggcttcctctcctgccgtgagccgtgca
aatcggtggggctttatgcccactccgggcagcagcggagtcagcacgccgtcgggttcg
gtgggatctggtggcgctagcaacgaacttcgcgagacactgccgctcaagagccgtcta
tttgcatggtgtagcgaatactacatcgagccgcagatgaagcaggcagaaagcgaggag
ccaggcagcatcaagtacaatgtgcagcactggaaaaaacaacgcaacagccgcctcact
gagcattctctggagattgccgacgtcgctgctcagtctgcctggtcagagcatggtggc
tatatccgcaatggcgccgtcccatacttgatgcttttccatcaatatgagaaccacctc
gtcacggctagcgatcaggatacggtcgctgtgtgggactgggaagagaagcgtctgctc
agtcgatttgccaacggcaatccgagcagaaccaacattacatcgacgctattcatcaac
gaagacagcgacgcgatgctgctagtcggctcggcggagggcaatgtgcgaatctacagg
cactacgattctcctgcgcatacggcaggcttccgaggtcccaagctcgcatcgagtttc
caggctcttccggatttagtgaggagcaagcgacccagcggtctagttgtcgactggttg
caaggatctggccacttgctcgcaggtggagatagtcgggtgattcgagtatgggatgcg
catcgcgagctttgtgtggtcgacattcccactcgagcttcgagctgtgtgacgtcgatc
tcttccgaatccgactttggccatctttttgtggctggatttggagatggcacggtcggt
gtatatgacagacgcaatccgcctgaagcgagcctggtgcgcttgtgggaggagcaccag
acgtgggtgcagaacgtgcatctgcagaagcgtggctcgcgagagctagtgactgccagc
gtcgacggtcaagtgcggctgtgggatatgcgtgtacgatcgtcgatcgcaaagttgagc
ctgggcggtaagttgggcggaaagctgtcgtgtatagcggtgcacgagcaaatcccgttg
tttgcggcgagctcggcacccaagccattgcgaccgacagcttcggctcagacggtgctg
ctgacacacctcgaaacgctgtcgacgctaggcaagccgatcgttcgtagttttgcaccg
atgggatccacgcaacatcttggcaacagcacgctgctgtacccgcccgaagcggtgaat
tctggcgtacatcatcaccattatctgcaccacctgcatcatcctggcgagacacatcat
ggcggaatgggtggaagcgggttcttgtcgatgcagcactcggcattctcggctggcaac
ggcggggctggaagcggtcttgtcgcaggaattagcgggaccagcagtggaatgcatcat
ggtccccatctgaacccagccaaccctttgcacgcgctcatgccgcccgccaccgaaatt
gccccgtcaggctttacacctgcgatgggaagtatggccttccatccgcacctgccaata
ttggcgtttggtggtccggatacgctgatcgaactcagggagtggcctgattccagttga

DBGET integrated database retrieval system