KEGG   Ustilago maydis: UM00903.1Help
Entry
UM00903.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
uma  Ustilago maydis
Brite
Enzymes [BR:uma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     UM00903.1
Peptidases [BR:uma01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   UM00903.1
Transcription machinery [BR:uma03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     UM00903.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 778 aa AA seqDB search
MPSSRASSASPTKLGHMASSQRSNNTGSVSPTKPSSASASRAGTPSLSSIGSGTDTHVRA
IPAGCHHLSSLLKLDAACSSTSFTKIKSEHGDETRRDSFDTLSDTTRSYLKRYIAGLRWG
GQIRSGHVKMMDDDEKQAELAKWNQEVAEAKKLGHQVKKRRKLDYPQCHTCHADMLRPFI
CLECAFTGCFSSPVHDDRTKPTRTSSDSHIIQHLQAKKHTLAFDLLYGHIYCASCKDFVH
DALLESIQRHETRRVNANVIGQQFGPRKTTLESLFPPSASDAAAAMATFYSTDTSSVTCR
VPRGLRNMGATCYMNVIIQAFLHNPLLRNYFLSDRHNASLCNGAKTCLACEMDKIFSEFY
SSDPGALAAGLGTGTGTTGPGASATTVADAMVRAASQNGTNIPAAKGPHGPISFLYCVWV
DQASSELGQAGQHDAHELFISALNSIHTALTSRAPERSSLPWFAYEHSDALNLLFDHYEG
SSGSGNQSEEEGMGGNGGTPMGLGARGNGGVAGCPCVVHRTFAGQLQSDVTCQRCGKVNT
TRDPMLDLSLDVRPESMRRKDANSVNAIGNNTKTKLLNGKPAAVHGNGAIEVQEEQHLTI
CLQRYCSEEKLGNNDYSCTGCGGSASATKQLSLYRLPPVLCIQLKRFEHTSSAAKIDTKV
RFPLVLDVRQFSTAEIRAPVDELNHGDSATSNKHTTLLANPDPEAYLYDLFTVVVHEGSM
NTGHYTNFSKWRGSWYRFDDDKVHATSEAQVLQARAYQLCYKRRLLKNIISSNAHSST
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgtcaagagcctcttcggcgtcacccaccaagcttggccacatggcttcgtcg
cagcgctccaacaataccggatcggtttcgcccaccaaaccgtcgtcggcaagcgcatcg
cgtgccggtacaccgtcgctctcgtcgatcggctcaggaacagatacacacgtccgcgcg
attccagctggatgccaccatctcagctcactgctcaaattggacgctgcttgcagctct
acgtcttttacaaaaatcaaatccgaacatggcgacgagacaagacgtgacagtttcgac
acactttccgatacaacaaggtcgtacttgaagcggtacattgctggactgcgatgggga
ggacagattcggagcgggcatgtgaagatgatggacgacgacgaaaagcaagccgaactc
gccaaatggaatcaagaggtggccgaggcgaaaaagttgggccaccaagtcaagaagcgg
agaaaactcgactatcctcaatgtcacacatgtcacgctgacatgctacgacctttcatc
tgcctggaatgtgcatttaccggctgtttctcgtcccctgtacacgacgatcgcaccaag
ccgacacgcacttcatccgatagccatataattcagcacctgcaagccaaaaagcatacg
cttgcgttcgatctcttgtatggccacatctactgtgccagttgcaaagactttgttcac
gacgcgttgctcgaatcgatccaacgacacgagactcgccgcgtcaatgccaacgtgatc
ggccaacaattcggtccgagaaagacaacactcgaatcgctcttccccccttcggcttca
gatgcagcagcagcaatggccacattctactcgaccgacacatccagcgtcacctgccga
gtacccaggggactccgcaatatgggcgcaacgtgctatatgaatgtcatcattcaggcc
ttcctgcacaacccgctacttcgcaattactttttatccgatcgacacaatgcttcgctt
tgcaatggagccaagacgtgcctggcttgcgagatggacaagattttttccgagttctac
tcgtccgatccaggtgcactggctgctggcctcggaacgggaacgggtacgactggtcct
ggcgcttcagcaaccacagttgcagatgcgatggtacgagctgcaagccagaacggcacc
aatatcccagcagcaaagggaccacatggacccatttcgtttctgtactgtgtctgggta
gatcaggcgagcagcgagctcggtcaggcgggtcagcacgatgcacacgaactgtttatt
tcagcactcaactcgatccacactgcactcaccagtcgggcaccggaacgatcgtcgctt
ccatggtttgcatacgaacattcggacgcgctgaatctgctgtttgaccactacgaaggc
agtagcggttcggggaatcagtccgaggaggagggaatgggtggcaacggcggtacgccg
atggggctgggtgctcgaggcaatggaggcgtggctggatgcccctgcgtggtgcatagg
acgtttgctggccaactgcagtccgacgttacgtgtcaaaggtgtggaaaggtcaatacg
acaagagatccgatgcttgacctcagcctggacgtgcgacccgaatcgatgcggcgcaaa
gacgccaacagtgtgaatgcaatcggcaacaacacaaagaccaagctgttgaatggcaag
ccagccgcagtacatggcaatggagcaatagaagtgcaagaggagcagcatctcaccatc
tgcttgcaacgatactgctccgaggaaaagttgggcaacaacgactactcgtgtacgggc
tgcggtggaagtgcgtccgcaacaaagcagttgagcttgtatcgattacctccggtattg
tgcatccagctcaagaggttcgaacacacgtcgtcggctgccaagatcgacaccaaggtg
cgattcccgctcgtgttggacgtacgccagttctcgaccgccgagatacgcgcccctgtg
gacgagctgaaccatggcgacagtgcaacatcgaacaagcataccacgttgctcgccaac
cctgatccagaagcgtacctgtatgacttgttcaccgtggtggtgcacgaaggatcgatg
aacacgggacactataccaacttttctaaatggagaggcagctggtaccgcttcgatgac
gataaggtgcatgctacgagcgaggcgcaggttttgcaggcgagagcgtaccagctgtgt
tacaagaggaggctgttgaagaacatcatcagttcgaatgctcactcgagcacatag

DBGET integrated database retrieval system