KEGG   Ustilago maydis: UM00955.1Help
Entry
UM00955.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
uma  Ustilago maydis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:uma01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:uma01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 544 aa AA seqDB search
MVAELKQRTTTATRDAPAAPKEEFADANIPDDYVSRVLATEKPLPPIQLKNILSEIQWVS
FLALTVTPILAIYGLFTTSWNTKTALWSFIYYFMTGLGITAGYHRLWAHRSYNATYPLQY
FLACMGSGAVQGSIHWWSRGHRAHHRYTDTDLDPYGAHFGLFWSHLGWMLVKPRRKPGVA
DISDLRKNPVIKFQHKFYIPMLLFFGFGLPTLVAGLGWNDWRGGFFFAGMLRLVFVHHST
FCVNSLAHYLGEATFDNKMTPRDHFFTALVTVGEGYHNFHHQFPMDYRNAVQWYQFDPTK
WFIASMYKLGLATHLKTFPDNEVKKGRLAMQLQKAHELGQQLEWPKSSAHLPVISWDDFV
EESKTRPLMVVHGFIHDVSSFLDEHPGGRHLLTGKIGKDATTAFLGGVYDHSNAAHNLLS
MMRVGVLDGGYQLAKDELAKAERENRATGVSSHRPAGSPPSPVTSDDEDFAAPATPTDDT
PMTTTSTVAAASEQLKAQQSADNVKSINAKAAAYVTPGEAYTIVKRGDLRENAKVGGTKF
GRFL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgaactgaagcaaaggactacgaccgctactcgggacgcgccggccgctcct
aaggaggagtttgccgacgccaacattcccgatgactacgtttctcgtgtgctcgccacc
gagaagcctcttcctcccatccagctcaagaacattctgagcgagattcagtgggtctct
ttcttggctcttacagtcacccctattctcgccatctacggtctcttcaccacaagctgg
aacacgaaaacagctttgtggtcttttatttactacttcatgaccggcctcggtatcact
gccggctaccatcgactttgggctcaccgttcctacaacgctacctatcctcttcaatat
ttcctagcttgcatgggctccggcgccgtgcagggttccattcactggtggtcgcgtggc
caccgtgcccaccaccgctacaccgacaccgacctcgacccttatggagctcactttggt
ctcttctggtcacacctcggctggatgcttgtcaagcctcgccgcaagcccggtgttgct
gacatctcagacttgcgcaagaaccctgtgatcaagttccagcacaagttctacattccc
atgctcctcttcttcggcttcggtcttcccacccttgtcgccggcctcggctggaacgac
tggcgcggaggcttcttcttcgctggcatgctccgtctcgtgtttgttcatcactcaacc
ttctgcgttaactcgctcgcccactatcttggcgaggctacgttcgacaacaagatgacg
cctcgtgaccatttcttcactgctctggtcaccgtcggcgagggttaccacaacttccac
caccagttcccaatggactatcgcaatgctgttcagtggtaccagttcgatcccaccaag
tggtttattgcctcgatgtataaactcggtctcgctacgcacctcaagacgttcccagac
aatgaagtcaagaaaggtcgtcttgcgatgcaactccagaaagcgcacgagctcggtcaa
cagcttgagtggccaaagtcgtcggcacacctgcctgtcatttcgtgggacgactttgtt
gaggagtccaagacccgccctctcatggttgtccacggcttcatccatgacgtctcttcg
ttcctggacgagcaccctggtggccgccatctcttgactggcaagatcggcaaggatgct
accactgctttccttggcggtgtctacgatcactcgaacgctgcgcacaatctgctctcg
atgatgcgtgtaggtgttcttgacggtggatatcagctcgccaaggacgagctcgctaag
gctgagcgcgaaaaccgcgccacgggcgtctcatctcaccgacctgccggctccccccct
tcgcccgtcacctcggacgacgaagactttgccgcccccgccacaccaaccgacgacact
cctatgacgaccaccagcaccgtcgctgccgcctctgagcagctcaaggctcagcaatcg
gccgacaacgtcaagtcgatcaacgccaaggctgccgcgtacgtgactcctggtgaggcc
tacaccatcgtcaagcgcggtgatctcagggagaacgctaaggtcggcggcaccaagttt
ggccgcttcctttaa

DBGET integrated database retrieval system