KEGG   Ustilago maydis: UM01035.1Help
Entry
UM01035.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
uma  Ustilago maydis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:uma00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 757 aa AA seqDB search
MKLSIITTLLGLVLTASSAVQATPAIPSQLTTDEITRISKLSRAEKLAFAEKILEIRTAY
EYEKQHGGALLHKRASPSGSFAPANMACPQRTSQQAPGFIRDANTKQLSNGEADYISRRR
QNTRSGWQKWLSQAKLDSVLPGGASNYTSDTDRLPRLGFALSGGGLRAMLVGAGTLQGFD
GRNETANSRGTGGLLQLAEYVAGLSGGSWATASLSMNNWATTQSLKDSIWNLESNLVVPK
DGKVSFYASILAAVAGKRTEGYQTSLTDYFGLSIADKILNGSTYGNKYSVEWSDVKNTSS
FTDASMPFPIIIADEREPDELIIPRNTTIWEFNPYEFGSWNPNVSAFIPIEILGSSLNNG
SSVLPDGACVGGYQTVAWVTGTSATLFSGLYLTLVSSSSDNIIVSALKEIAQAVSQEKND
VSLVPNPFYGYRGNGNVQVADFRNITLVDGGLDNENVPLWPLVEPARGLDAVIAIDSSAD
ITNWPNASALYQTSLRALYPKYRNYAFPRIPDTNTIINRGLNTRPVFYGCDASANVTNSA
TSYNETKTPIVIYMPSYPYSALANTSTYKLDYSKRQAQGVIDNSVQVATLGGADDSWSTC
LGCALLQRGFERSRTPTPDVCTTCLQKWCWDGVTNTTQPTYSYSPAIGVPEFVSSNGSLQ
RAPAYTGGNGSNSQASDASDDSDSAENNTAHTTRASLLALALSALIALANYEMHQTRCKP
LAQGHGGLYSILGGFSFVGGLTTKQAMPNSWVMVVMT
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtcaatcatcactacgctgctcggcttggtgctgacagcgtcttccgccgtt
caagcgacgccagccatcccatcgcagctcacaactgacgagattacacgcatcagcaag
ctttctcgcgccgaaaagctcgcctttgccgaaaagatcctcgagattcgaaccgcctac
gagtacgaaaagcaacatggtggtgcgcttttgcacaaacgtgcttctccctcgggctcg
ttcgctccggctaacatggcgtgtcctcagcgtacctcgcagcaggcacccgggtttatc
cgcgacgccaacacaaagcagctttccaacggcgaagcggattacatctcgcgtaggagg
cagaacacgcgttcgggctggcagaagtggttgtcccaagcaaaactcgattcggtgctt
cccggtggtgcgtccaactacaccagcgacacggatcgtctgcccaggttgggtttcgcg
ttgagcggtggtgggttgcgcgctatgcttgtcggcgcaggtacgctgcagggcttcgat
ggcaggaacgagacggccaacagtcgtggcacgggtggattgttgcaacttgccgagtac
gttgctggtttatccggtggaagttgggccaccgcgtcgctgagcatgaacaactgggcg
acgactcagtcgctcaaggactcgatttggaacttggagtccaacctggttgttcccaag
gacggcaaggtctcgttctacgcttccatcctcgcagccgtcgcaggcaagcgtactgaa
ggataccagaccagtctgaccgactactttggcctttcgatcgccgacaagatcctcaat
ggctcaacgtatggcaataagtacagtgttgaatggagcgatgtcaagaacacgtcttcg
ttcaccgacgcttccatgccgttccccatcatcattgcagatgaacgagaaccggatgag
ctcatcatcccgcgcaacaccaccatctgggagtttaacccgtacgagttcggatcttgg
aaccccaacgtctcggcgtttatcccgatcgagattctgggttccagtctgaacaacgga
tcgagcgtcttgccggatggggcgtgtgttggaggctaccagacggtcgcctgggtgacc
ggaacatcggcaacgctattctcgggtctctacctgacgctcgtcagcagttcgagcgac
aacatcatcgtcagcgctctcaaggagatcgcacaggcggtatctcaggaaaagaacgac
gtctcgcttgtgcccaatcccttctacggttatcggggcaatggcaatgtgcaagtggca
gactttcgcaacatcacattggtagatggaggcttggacaatgaaaacgttccattgtgg
ccgttggtagagccagcgcgaggcttggatgctgtgatcgcgatcgacagttcggccgac
atcaccaactggcccaacgcatctgcgctatatcaaacctcgttgcgagcgctgtaccca
aagtatcgcaactacgcattcccgcgcatacccgatacaaacacgatcatcaaccgcggt
ctcaatacgcgacctgtcttctacggctgcgacgcgtcggctaacgtaacgaattccgcg
acgagctacaacgagaccaagacgccgattgtgatctacatgccttcgtatccctactcg
gcactggcgaatacgtcgacgtacaaactcgactactcgaagcgtcaagcgcagggcgtg
attgacaactcggtccaagtggctacgcttggtggagcggatgattcgtggtcgacctgt
ttgggctgtgctttgctgcagaggggattcgagaggagccgtacaccgacgccagacgtt
tgtacgacgtgtttgcaaaaatggtgctgggatggcgtcacaaataccacgcagcccacg
tacagctacagtcctgccataggcgtgcctgagtttgtaagcagtaacggatccctccag
cgcgcacccgcctataccggcggtaatggttccaacagccaggcatccgacgccagcgac
gactctgactcagccgaaaacaacaccgcccacaccactcgtgctagtctcctcgccttg
gctctctcggctctcatcgcactcgcgaattacgaaatgcaccaaacaagatgcaagcca
ttggcacaaggacacggcggtctctactcgatcttgggcgggttcagctttgtgggtggc
ttgacgacgaagcaggccatgcccaactcgtgggtgatggtggtgatgacgtga

DBGET integrated database retrieval system