KEGG   Ustilago maydis: UM01124.1Help
Entry
UM01124.1         CDS       T01021                                 

Definition
similar to cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
uma  Ustilago maydis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:uma00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    UM01124.1
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     UM01124.1
Protein kinases [BR:uma01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   UM01124.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 398 aa AA seqDB search
MIEDIVDTLSVPLLGACASHVSRPTLMPSLASRSGPPAASSSDPKTSSSSTEKVAKSVGS
ASPLRSSPNRPYALSDFEVVETLGTGTFGRVLLVRLKDRDVADRSAYFALKVLAKTDVIK
LKQVSHINSERCILTKVDHPFLVNMIASFQDSKNCYMLMEYVVGGEIFSYLRRAGHFSAD
VARFYISTIVLAIEYLHSNKVVYRDLKPENLLIDSNGYTKITDFGFAKEVEDRTWTLCGT
PEYLAPEIIQCSGHGSAVDWWSLGILLFEMLAGYPPFYDPNPILIYEKILAGNLVFPEEI
DPLSRDLISSLLTADRSRRLGNLRGGANDVKNHPWFHGVDWKALQEGRILPPIVPYLGRP
GDTSNFSKYEPARPSAMPGLYGADSGHHDLYADLFPDF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggacatcgtcgacacgctctcggtccccttgctgggggcttgtgcatcgcat
gtttctcggcccaccttgatgccgtctttggcatctcgcagcggtccgccggcagcatct
tcgtctgacccaaagacgtcatcgtcctcgacagaaaaggttgcaaaaagcgttggctca
gcatctccgctgcgatcctctcccaaccgtccttacgcgctctcagattttgaggttgtc
gaaacattgggaacaggtacctttggtcgcgtgttgttggtacgtctgaaagatcgcgac
gttgcggatcgctcggcctactttgcgctcaaggtcttggccaagacggatgtaatcaag
ctcaagcaggtctcgcatatcaacagtgagcgctgcattttgaccaaggtggatcatcct
tttctcgtcaacatgatcgcttccttccaggatagcaagaactgctacatgctgatggaa
tatgtcgtcggcggcgagatcttttcgtacttgcgcagagcaggtcatttctcggcagac
gtagctcgcttctacatctcgaccatcgtactggctatcgaatacctccatagcaacaag
gtggtgtaccgagacttgaagccggaaaaccttctaatcgactcgaacggctacaccaag
atcaccgactttggatttgccaaggaggttgaagatcgaacttggacgctctgcggcaca
cccgagtatcttgcgccagaaattatccagtgcagcggtcatggtagcgccgtcgattgg
tggtcattgggcattctgcttttcgagatgctagccggctacccaccattctacgacccc
aacccaatcttgatctatgaaaagattctggctggcaacctcgtctttcccgaggagatt
gacccgctctcgcgcgacctcatctcgagccttctaacggctgaccgtagcaggcgtctc
ggcaaccttcgtggtggtgcgaatgacgtcaagaaccatccttggttccatggtgtcgac
tggaaggcgttacaggagggcaggatccttcctcccattgttccctacctcgggcgacca
ggcgacacatccaactttagcaagtacgagccagccagaccgagcgccatgcctggcctg
tatggcgctgattcaggtcatcatgatttatacgccgacctctttccagacttctaa

DBGET integrated database retrieval system