KEGG   Ustilago maydis: UM01230.1Help
Entry
UM01230.1         CDS       T01021                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
uma  Ustilago maydis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    UM01230.1
Enzymes [BR:uma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     UM01230.1
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1883 aa AA seqDB search
MSQVPVASPASWSSVASAAAAAVSAATSASSSLAASVDEPAATTATAATASYADERNPLI
ALFDGLLRVVLASLNLIRILATFSTITVPSLVYAILHYSLTLQLNFPSLALLFLTSLISA
FIWLRYRHLNKYERLREVPITRDEGFNLNPDVASPGGDNDRGSFHNYLDDFLQAIRIFGF
LEKPVFHELARHLQTRRLVAGDSLSLDTDFSFYIVIDGHVQVYAPLPSATASAVGQDSVE
DEDDSGYQLLNEVESGGTLSSLFTILSLFTEDVKLSFDDHDDPHLAPPHPAYPAMDRLNN
SSAANHLGRGNNATAPTSPYSSAFNPPSQTAAQLQLNAAALRNVPAAISTEGAVERLGGS
AAVRSTSKSSHARTASSGTASATVQDGDTSTIMDPLEQNDDGVTSSLYHAPDLQMPPAQA
AAPFSHFAPSYHPSPAGTPISSLPGSTHSPYFRGRATSIHALHEAAGGPNTPGSILSAMS
SSAHGHYHPQADYLPRQGAGTVARATVDTTLAVIPAEAFKRLTKKFPNAAAHIVQVILAR
LSRVTFHTAHKYLGLTKEVMRTEKSINDLACFPLPSEFYEKGGMDKLRHRFLPQPNSKRE
TTVDDDYFRDFQEWTSISQRSSTPVPGSKDDTKDAATSSPPKVRIASDLPSLTTSSKQSN
QKPTSSRISAARTPWGHPDPPLKTPTARNMVGPGDLLSMASLSQDGWYTTGFDMHSAQPT
PRAKPRSVSKLEPFHGPLPHPVDDSTDGTSPLSGASPIPIRKGSSTMYHQGEAIGTDRPF
ANIGLPHFDIKNEVMDCIAKSIGLAQAAHSPLAPSYQASPHINAQDSLLQRSVFKSAFGS
LSMLDAAMAEEESSITGTNSSMAGHGHSGFHPSDFENEVEIKFFPAGSTLVKAGESRAGL
FYVIDGFLDVLLPAEANELEEEDRLKPNMNHKSAKTDASSGSSRQNRPGSHRKDSSSASL
RAGLLDERNLREADVSLPQRRGTEADRISSNGDGNSGSVHRPAMREGSSSSTSYGTPAGL
RKKPTESAKVGNALDGTGGAGSSSRRKPSHVSSGSGATTMPRHPDATNSNMAFTAKQPVL
HPSLHQQQPLRGKPSQQSSQRSKDGKRSIFTVGRGGIAGYLSSLLGTASYVDITAKTDVY
VGFLPAHALERIMERRPIVLLTLCKRLLSLLPPLILHIDSSLDWQQVNAGQVIYREDDPS
DSFFIVINGRLRAITEKTNGIEVHNEYGQGDSVGELDVITNSRRRTTLHAIRDSELAKMP
STLFNAISVRHPAITIQISRIIARRVRTELVRSKQEGAALGAPIPGLPDLGRNNLNLKTV
AIVPVTRQVPVIDFAAKLQTAFDDTIGGRAIFLDQSSVMGVLGRHAFSRMGKLKLAGWLA
DLEQKYRLVVYVVDTPVSSAWSQTSIRQADCVLMVGFGDEPAMGEYERLLMSVKTTARKE
LVLLHPERSVPPGSTREWLKNRPWVHAHHHVEMPGLTGSHAGAAISTGGDPKAVKALRNL
KQKLETSLQRYRKTMTPLSASGRPHHASDFARLARRLCGMSIGLVLGGGGARGCAHLGVI
RALEERGIPIDMVGGTSIGSLVGGLYAREAEMVSTFGRAKRFAGRMASLWRFASDLTYPV
VSYTTGHEFNRGVFKAIQETHIEDMWIPFFCNTTNITWSRMEVHTSGYAWRYIRGSMTLA
GLIPPLVDEGNMLVDGGYVDNLPVTVMLAMGARSVFAVDVGSIDDTSPRAYGDTLSGWWV
LLNRWNPWSDASKIPSIPDIQGRLTYVSSVKTLEEAKKVKGCFYMRMPVEEFGTLAFGRF
DMIYEKGYKAAVELLDGWDAEGKLPSGTEREDFEDDWEDGDEYEEYEVYTDDESGVGGGV
RKIRKKRRRTRRKAGISARRNSI
NT seq 5652 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggtccctgtggcctcaccggcctcctggtcgtcagtcgcttcagccgccgca
gccgccgtatcggctgctacaagtgcatcgagctcgctggctgcttctgttgatgagcca
gcagccactacggctactgcagcaaccgcttcttacgcagacgaacgaaaccctctcatc
gcattgttcgatggcctcctccgcgtcgtacttgcctcgctcaacctcatccgcatcctg
gccactttttccaccattacggtcccaagtctggtctatgccattcttcactacagtttg
acgctccaactcaactttccgtcccttgctctcctctttctcacttcgttgatatccgct
ttcatctggcttcgctaccgtcatctcaacaagtatgagcgcctccgcgaggttcctatc
actcgagacgagggcttcaacctcaaccctgacgtcgcctcacccggcggagacaacgac
cgcggcagctttcacaactacctggacgactttcttcaagccatccgcatctttggtttc
ctcgaaaagcctgtttttcacgaactcgctcgccatttgcaaacgcgtaggctcgttgct
ggtgatagcctatccctcgacacagatttttccttttacattgtcatcgacggccatgtt
caggtttatgcgcctcttccgtctgccactgcaagtgcagtgggacaggactcggtcgaa
gacgaagatgacagtggctaccagttgctcaacgaagtcgagagcggaggcacgctcagc
agtctctttaccattctcagcctcttcaccgaggatgtcaagctttcgttcgatgaccat
gatgaccctcatctcgctcctccccatcctgcctatcccgccatggatcgtctcaacaac
tccagcgcagccaaccatctaggtcgtggcaacaacgctactgcccctacttcaccctat
tcctcggccttcaacccaccatctcaaaccgctgctcagcttcagcttaacgcagctgcc
ctccgcaatgtacccgctgccatttccaccgaaggtgctgtagaacgcctcggaggttcc
gccgctgtccgctccacttccaaatcgtctcacgcccgaaccgcgtcctctggcaccgca
tctgcgacggttcaggatggtgacacgagtaccatcatggatccactagagcagaacgac
gacggcgtcaccagttctttataccatgcacccgatcttcaaatgcctcctgcacaggcc
gccgctcccttttctcacttcgcgccatcctaccacccttcgcccgcaggtacaccaatt
tcgagcctgccgggatccacgcactccccttattttcgcggcagagcgacgtctattcac
gctctgcacgaagctgctggtggccccaacacacctggatcgatcctcagcgcaatgagt
agcagcgcacacggtcattaccacccacaggccgactaccttcctcgacaaggtgcaggt
accgtagcacgcgccactgtcgacaccacccttgccgtcatccctgccgaagccttcaag
cgtcttaccaaaaagtttcccaacgctgctgcgcacatagttcaggtcattctggcccgt
ctctcgcgcgtcaccttccacaccgcccataagtacctcggtcttaccaaggaggtcatg
cgaactgaaaagtcaatcaacgatctcgcctgcttcccgcttccctctgaattttacgag
aagggcggcatggacaaactccgccatcgcttccttccacagccaaattcgaaacgcgaa
acaacggttgatgatgactatttccgcgatttccaggaatggacatcgatcagtcaacgc
agctccacgcctgtgccaggatccaaagatgacacgaaggatgccgccaccagcagtccg
cccaaggtcaggattgcctcagatttgccgtcactgacgacgagctccaaacaatccaac
caaaaaccaacatcctcgcgcatctctgcagccaggacgccatggggacatccagatcca
cctctcaaaacacccacggctcgcaacatggttggaccaggcgacttgctcagcatggcc
agtctcagccaagatggctggtacacgaccggcttcgacatgcactcggcgcagccaaca
ccacgggccaagccacgctctgtctccaagctcgagccttttcacggtcccttgccgcat
cctgtggatgattccactgacggcacaagtccgctttcaggtgcctcgccaattccaata
cgcaaaggcagttccaccatgtaccatcaaggcgaagccattggcactgatcgtcccttt
gcaaacattggcctgcctcattttgacataaaaaacgaggtcatggactgcatcgcgaag
agtatcggcctcgctcaggctgcgcactcaccgcttgctccaagctaccaggctagccct
cacattaatgcgcaggattctcttctgcagcgctccgtgttcaagtcggcttttggctcg
cttagcatgctcgatgctgctatggcggaagaagagtcgagcatcacgggtaccaacagt
tccatggctgggcacggccattcgggttttcatccctcggatttcgagaacgaggtcgag
atcaagttcttccctgccggaagtaccctcgtcaaggcgggggagagtcgtgccggactg
ttctatgtcatcgacggctttttggacgttctactgcctgccgaggccaatgaattggag
gaagaagatcgtttgaagcccaacatgaatcacaaatcggcgaagactgatgctagcagt
ggctcttcaagacaaaacagaccaggctcgcatcgtaaagattcgtcatctgcttcgctg
cgagcgggtctcctcgatgaaagaaatctgcgtgaagctgatgtgtcactacctcaacgc
agaggcaccgaagcagatcgcattagcagcaatggcgatggcaattcgggctcggtacat
cgacctgctatgcgtgaaggttcttcatcgtccacctcgtatggcacgccggccggcttg
cgcaaaaaacccacagaatcagcaaaggtgggcaatgctttggacggcactggtggcgct
ggtagcagtagcagacgcaaaccaagccatgtttccagcggaagtggtgccactacgatg
ccgcgtcatccagatgccaccaattccaatatggcattcacagcaaagcagccggtcttg
cacccttcactgcatcaacagcaacctctccgcggcaagccctcacagcaaagtagtcag
cgctccaaggacggcaagcgctccatctttaccgtcggtcgtggaggcattgcaggctac
ctctccagtctcctaggtactgcaagctacgtcgacatcacagccaagacggatgtgtat
gtgggctttttacctgcgcacgctctcgagcgcatcatggaacgtcggccgatcgtgctg
ctgacgctgtgcaagcgtctgttgagtctgctgcctccgctgatccttcacattgattcg
tcgctcgactggcagcaagtcaatgcagggcaggtaatctatcgtgaggatgatccatct
gacagctttttcattgttattaacggacgattgcgagcaattaccgagaaaactaacggt
attgaggtgcataacgagtacggacaaggtgacagtgttggcgagctcgacgtgatcacc
aactcgcgcagacgcacgacgctccatgccatccgtgattcggagctggccaagatgcct
tcgacgctgttcaacgccatctcggtgcgtcacccagccatcactattcaaatctcacgt
atcattgcgcgtcgagtgcgcacagagctcgtgaggagcaaacaggaaggtgctgcgctt
ggcgcgcctattccgggcctgccagaccttggtcgcaacaatctcaacctcaagacggtg
gccattgttcccgtaacacgccaggtgcccgtgattgactttgcagctaagctgcagacc
gccttcgacgacaccatcggtggcagagcgattttcttggatcagagcagtgtcatgggc
gtgctgggacgacatgcctttagccggatgggcaagctcaagctggcgggctggctcgcc
gacttggagcaaaagtatcgcttggttgtgtatgtggttgacacccccgtttcgtcagcc
tggtcgcaaacttcgatccggcaggccgactgcgtactcatggtcggattcggcgatgag
ccagcgatgggcgagtacgaacgactgctgatgagtgtcaagaccacagcgcgcaaagag
ctcgtactgttgcatcccgagagaagcgtcccacctggttcgacgcgcgagtggctcaag
aaccgcccgtgggtgcatgcgcaccaccatgtagagatgccgggcttgaccggatcgcat
gccggcgcagccatatccacgggaggtgacccaaaggcggtcaaggcgctgcgcaacctg
aagcagaagcttgagacgtcgctgcagcgataccgcaagaccatgacgccactctctgca
tctggtcggccccaccatgcatccgattttgcaaggctggcacgtcgattgtgcggtatg
agcatcggactggtgctcgggggtggtggtgcgcgtggctgtgctcacttgggtgtcatc
cgtgcgcttgaagagcgtggaattccgatcgacatggtgggtggtacatcgattggctcg
ctcgtgggcggactgtacgcgagagaggccgagatggtgtcaacgtttggtcgcgccaaa
cgctttgcaggccgtatggcgtctctgtggcgttttgcctcggatctcacctatccagtg
gtctcgtacaccacggggcacgagttcaaccgtggcgtattcaaagcgatccaagagacg
catattgaggatatgtggattccgtttttctgcaacacgaccaacatcacctggtctcgc
atggaggtacacacgagcggctatgcctggcgctacattcgcggatccatgacactggcc
ggtctcatcccgccgctggtcgacgaaggaaacatgcttgtcgacggaggctacgttgac
aatttgccggtgactgtgatgctggccatgggtgcacggtccgtgtttgcggtcgacgtc
ggatccatcgacgatacgagcccacgtgcatacggcgatacgttgtctggctggtgggtg
cttctgaatcgatggaacccgtggtcagacgccagcaagataccttcgattccagacatt
caaggccgtctgacctatgtgtcgtcggtcaagacgctcgaagaagccaagaaggtgaaa
ggatgcttctatatgcgaatgcctgtggaagaatttggaacgctcgcattcggacgcttc
gacatgatttatgaaaagggttacaaggcggcggtggagttactcgatggttgggatgca
gaagggaaattgccgtctggaacagagagggaagattttgaagacgactgggaggatggc
gacgagtatgaagagtacgaagtgtacaccgacgacgaaagtggggtcggtgggggagtc
agaaagatcagaaagaagcgaagaagaacgaggagaaaggcggggatcagcgctcgtcgc
aacagcatctag

DBGET integrated database retrieval system